KEGG   Mycobacterium sp. EPa45: AB431_11255Help
Entry
AB431_11255       CDS       T03960                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00020  Citrate cycle (TCA cycle)
mye00620  Pyruvate metabolism
mye01100  Metabolic pathways
mye01110  Biosynthesis of secondary metabolites
mye01120  Microbial metabolism in diverse environments
mye01130  Biosynthesis of antibiotics
mye01200  Carbon metabolism
Module
mye_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mye_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB431_11255
   00620 Pyruvate metabolism
    AB431_11255
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AB431_11255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKK27163
UniProt: A0A0G3II05
Position
2371049..2372620
Genome map
AA seq 523 aa AA seqDB search
MSDTTKTDVVLVGAGIMSATLGALLRLVQPDWSITLVERLDAAAAESSDPWNNAGTGHSA
LCELNYTPEKADGSIDIAKAINVNEQFQVTRQFWSYAHEHGILPDVRSFLNPIPHVSFVQ
GAEHVDYLRRRRETLVRNPLFATMEFIDDPDEFTRRLPLMAKGRDFSEPVGLNWTQDGTD
VDFGSLTRQLLAFGTERGMSTLFGHDVVDLHKESGGGWTVKVHNRRTGQKRKLSAKFVFV
GAGGGALPLLQKAGISEAKGFGGFPVSGQWLRTGNAELAAAHQAKVYGLPPLGAPPMSVP
HLDTRVINGRSWLLFGPFAGWSPKFLKEGKITDLPLSVKPNNLASMIGVGLTEMGLLKYL
IGQLALSEADRVDNLREFAPTARDSDWELDIAGQRVQVIRRDSKKLGVLEFGTTVLAAAD
GSIAGLLGASPGASTAVPAMIEVLERCFADRYQSWLPKLKEMVPSLGVKLSENPDLFGEV
WAHGTKVLGLESATHAGRAAQVAGPDRTPVASDSGDPEPAGVV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagataccaccaagaccgatgtcgtattggttggcgcgggaatcatgagcgccacg
ctgggtgccctgcttcggctggtccagccggactggtcgatcaccctggtcgaacgcctg
gatgcggccgccgccgagagctctgatccgtggaacaacgccggcaccggccactccgcg
ctgtgcgaactcaactacacgccggagaaggccgacggcagcatcgacatcgccaaggcc
atcaacgtcaacgagcagttccaggtcacccgtcaattctggagctacgcccacgagcac
ggcatcctgccggacgtccgcagcttcttgaacccgatcccgcacgtcagcttcgtgcag
ggtgccgagcacgtcgactaccttcgccggcgtcgcgagaccctggtgcgcaacccgctg
ttcgccacgatggagttcatcgacgaccccgacgagttcacccgccgcctgccgctgatg
gccaagggccgcgacttctccgaaccggtcgggttgaactggacccaggacggcaccgac
gtcgacttcggatccctgacccgccaactgctcgcattcggcaccgagcgaggcatgtcg
acgttgttcggccacgacgtggtcgatctgcacaaggagtccggcggcggctggacggtc
aaggtccacaatcggcgcaccggccagaagcgcaagttgtcggcgaagttcgtattcgtc
ggcgccggcggcggtgctcttccgctgttgcagaaggccggcatctccgaagccaagggt
ttcggcggcttcccggtcagcggtcagtggctacgcaccggcaacgccgaactggccgcg
gcgcaccaggccaaggtttacggcctgccgccgctcggtgccccgccgatgtcggtgcca
cacctggacacccgcgtcatcaacggccgctcctggctgctgttcggcccgttcgccggt
tggtcgccgaagttcctcaaggagggcaaaatcaccgacctgccgttgtcggtcaagccc
aacaacctcgcctcgatgatcggcgtcgggctcaccgagatgggtctgctgaagtacctg
atcggccagctggcgctcagcgaagccgaccgtgtcgacaacctccgcgaattcgcgccc
actgcaagggattccgactgggagctggatatcgccggtcagcgagtgcaggttatccgc
cgcgactccaagaagctcggcgtgctcgaattcggcaccaccgtactggcggccgccgac
ggttcgatcgccggcctgctcggcgcgtccccgggcgcctccaccgcggtccccgcgatg
atcgaggttctggagcgctgcttcgccgaccgctaccagagctggctgcccaagctcaaa
gagatggtgccctcgctgggcgtcaaactgtcggagaacccggacctgttcggtgaagtg
tgggcgcacggcaccaaagtgctcggactggagagcgcaacccacgccggccgggccgcg
caggttgccggccccgaccgcacacccgtcgcttcggattccggtgacccggaacccgcg
ggagtggtgtga

DBGET integrated database retrieval system