KEGG   Mycobacterium sp. EPa45: AB431_14095Help
Entry
AB431_14095       CDS       T03960                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00010  Glycolysis / Gluconeogenesis
mye00053  Ascorbate and aldarate metabolism
mye00071  Fatty acid degradation
mye00280  Valine, leucine and isoleucine degradation
mye00310  Lysine degradation
mye00330  Arginine and proline metabolism
mye00340  Histidine metabolism
mye00380  Tryptophan metabolism
mye00410  beta-Alanine metabolism
mye00561  Glycerolipid metabolism
mye00620  Pyruvate metabolism
mye00625  Chloroalkane and chloroalkene degradation
mye00903  Limonene and pinene degradation
mye01100  Metabolic pathways
mye01110  Biosynthesis of secondary metabolites
mye01120  Microbial metabolism in diverse environments
mye01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB431_14095
   00053 Ascorbate and aldarate metabolism
    AB431_14095
   00620 Pyruvate metabolism
    AB431_14095
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB431_14095
   00561 Glycerolipid metabolism
    AB431_14095
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB431_14095
   00310 Lysine degradation
    AB431_14095
   00330 Arginine and proline metabolism
    AB431_14095
   00340 Histidine metabolism
    AB431_14095
   00380 Tryptophan metabolism
    AB431_14095
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB431_14095
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AB431_14095
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AB431_14095
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AB431_14095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: AKK27625
UniProt: A0A0G3IJB2
Position
complement(2969973..2971424)
Genome map
AA seq 483 aa AA seqDB search
MLIDGKLVDSETGARFDNINPATEEVLGSTADGTRADMERAVAAARHTFDNTDWSRNGEL
RAHGLRQLQAALEAEREELRSELIAEVGCPLLSTFGPQLDVPLKEALSWPADMISEFAWK
RSLPDKDAFGMGTPAAREVWKEPVGVVGVVTPWNFPFEIILNKIGPILAMGNTMVLKPAP
DTPWNATRIGRIIAEQTDIPPGVINIVTSSDHLVGEVLSTSPLVDMVAFTGSTATGRRIM
KAAADTVKPTFLELGGKSVYLVLEDDGDMKATVAGSAFISMHAGQGCAMPTRLLVPNSRY
DEAVEIVKVAMEKNKYGDPTDASVLQGPQVSKRQQERVLGYIETGKREGAQLVTGGGVPK
DTPKGFFVEPTVFAGVDNKMTIAQEEIFGPVLSVIGFDSDDDAVRIANDSIYGLSGVVFA
NDLERAKNVASRIRTGTLGINGGLWYGADAPFGGYKQSGIGRQCGIEGLEIFTETKTVGW
PAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgacggtaaactcgtcgactcggagaccggtgcgcgtttcgacaacatcaat
ccggccaccgaagaagtgctcggaagcaccgcggacggcacccgcgccgacatggagcgt
gccgtcgctgccgccaggcacaccttcgacaacaccgactggtcacgcaatggcgaactg
cgcgcccacggcttgcgccagctgcaggctgcgctcgaggcagaacgcgaggagttgcgc
agcgagctgatcgccgaggtcggctgccctctactgagcaccttcgggccgcagctcgac
gtgccgttgaaggaggcactctcctggcccgccgacatgatcagcgagttcgcctggaag
cgttcgcttcccgataaggacgccttcggcatgggcacccccgcggcacgcgaggtctgg
aaggaaccggtcggcgtcgtcggtgtggtgaccccgtggaacttccccttcgagatcatc
ctgaacaagatcggccccatcctggcgatgggtaacacgatggtgctcaagcccgcgccg
gacaccccgtggaacgcgacgcgtatcggcaggatcatcgccgagcagaccgacatcccg
ccgggcgtgatcaatatcgtcacgtcctccgatcacctggtgggcgaggtgctgtccacc
tcccccctggtcgacatggtggccttcaccggctcgacggcaaccggacgccgcatcatg
aaagccgccgccgacaccgtgaagccgacgtttctggaactcggtggcaagtcggtgtac
ctcgtactcgaggacgacggcgacatgaaggcgaccgtggccggcagcgcgttcatctcg
atgcacgccgggcagggctgcgccatgcccacccgactactggtaccgaattctcgttac
gacgaagccgtcgagatcgtcaaggtcgcgatggagaagaacaagtacggtgacccgacc
gacgcctcggtgctgcagggtccgcaggtctccaagcgccagcaggagcgcgtactcggc
tacatcgagacgggcaagcgggaaggcgctcagctggtgaccggcggcggtgtaccgaag
gacactcccaagggtttcttcgtcgagccaacggttttcgccggggtcgacaacaagatg
acgatcgcgcaggaagagatcttcggtccggtgctgtcggtcatcggcttcgactccgac
gacgacgcagtccgcatcgccaacgactccatctatggcctgtcgggcgtggtgttcgcc
aacgatctcgagcgcgcgaagaatgtcgcgtcacggatccgtactggcacgctcggaatc
aacggcggcctctggtacggcgccgacgctccatttggcggctacaaacaatccggtatc
ggtcgccaatgcgggatcgaggggttggaaattttcaccgaaaccaagacggtcggctgg
ccggctcagtag

DBGET integrated database retrieval system