KEGG   Mycobacterium sp. EPa45: AB431_15620Help
Entry
AB431_15620       CDS       T03960                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AB431_15620
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AB431_15620
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AB431_15620
    1.1.1.-  
     AB431_15620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AKK27879
UniProt: A0A0G3ILW3
Position
complement(3271144..3272169)
Genome map
AA seq 341 aa AA seqDB search
MDAIVLRGNKDVGLESVPDPTPQAGEVIIEVAATGLCGTDLHEYLAGPTFSQPPVVLGHE
VSGRIVEVGSGVDRSRIGEGAVVIPMDFCDSCHYCHRALYHLCQRPEWIGLTRNGGLARY
VAVPSRLATRVPEGVDIAEAALTEPTAVAFHAVRRAELLLGETVLVLGAGALGLAVIQCA
RAAGAARIYAMEPSGIRRRLARDVGATVALDSRDPESTARILEETRGIGVDVVFHAAGSA
EAFTTGLNCLRKQGRFMEMSSWAGTASLDVNQHLIKEPQLRLVFGYDMFDDFPAVLALMA
DGTVALAPQITARVPLGSAIEDGLAALVEGREDQIKVLVTP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgattgtccttcgaggcaacaaggacgtcggcctggagtcggtcccggacccg
acgccgcaggccggcgaagtcatcatcgaggtggcggcaaccgggctgtgcgggaccgat
ctccacgagtacctggcagggccgaccttctcgcagccaccggtggtcctcggacatgag
gtctctggccggatcgtggaggtcggctctggtgtcgaccggtctcggattggcgagggc
gccgtggtgatcccgatggatttctgcgacagctgccattactgccaccgtgcgctctac
cacttatgccagcgcccggagtggatcggcttaacccgcaacgggggactggcacgctac
gtcgcggtgccgtctcgcctcgcgacccgggtgcccgaaggggtagacatcgcggaggcc
gcactgaccgagccgaccgcagtggccttccacgcggtgcgccgggcggagctgctcctc
ggcgagacggtgctggtcctcggggcgggggccctcggcctggcagtgatccagtgcgca
cgcgccgccggcgccgcgcggatctacgccatggagccgagcggtattcgccgacgcctt
gcccgcgacgtgggcgccacggtggcactggattcgcgtgaccccgagtccaccgcacgg
atcctcgaggagacccggggcatcggtgtggatgtcgtctttcatgcggcgggcagcgcc
gaagcgttcacgacgggcctgaactgcctacgcaagcagggccgcttcatggagatgtcg
tcgtgggccggtacagcctcgctcgatgtcaaccagcatttgatcaaggagccgcagctg
cggctcgtcttcggttacgacatgttcgacgacttccccgccgtgctcgcgctgatggca
gacggaacagtcgcgctcgctccgcagatcaccgcccgggtgccgctgggcagcgctatc
gaggatgggttggctgcgctggtggaggggcgggaggaccagatcaaggtgttggtgacg
ccgtga

DBGET integrated database retrieval system