KEGG   Mycobacterium sp. EPa45: AB431_21555Help
Entry
AB431_21555       CDS       T03960                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00650  Butanoate metabolism
mye00900  Terpenoid backbone biosynthesis
mye01100  Metabolic pathways
mye01110  Biosynthesis of secondary metabolites
mye01120  Microbial metabolism in diverse environments
mye01130  Biosynthesis of antibiotics
mye01200  Carbon metabolism
mye01212  Fatty acid metabolism
mye02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB431_21555
   00630 Glyoxylate and dicarboxylate metabolism
    AB431_21555
   00640 Propanoate metabolism
    AB431_21555
   00650 Butanoate metabolism
    AB431_21555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB431_21555
   00072 Synthesis and degradation of ketone bodies
    AB431_21555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB431_21555
   00310 Lysine degradation
    AB431_21555
   00380 Tryptophan metabolism
    AB431_21555
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB431_21555
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB431_21555
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB431_21555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mye04147]
    AB431_21555
Enzymes [BR:mye01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB431_21555
Exosome [BR:mye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB431_21555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKK28826
UniProt: A0A0G3IU71
Position
complement(4525325..4526488)
Genome map
AA seq 387 aa AA seqDB search
MHVVHPQDLLAQCLAAAVQRVGFDPAEVDDVIAGNGIMAGEHGDDIARLSLLLAGWPQSV
PGMTLNRFCGSGQQAVTVAAAGIASGQQELVVAGGVESMSRWNVTVGAPTIDGANPAFRQ
LYPTVPQGISADLIASLEGFSRADVDAFAVSSQDRAAAAIGGGYFDGSVIAVRNGDGDIV
ADRDEHPRPGTTLEKLGGLPAAFERMGAARLEGESLTFDEICLSRYPDVERIDHVHHAGN
SSGVVDGAAVVTVASAGWVKAHGVTPRARIRAAAAIGSEPIIMLTAPGPAAERCLAKAGM
AVGDVDLWEINEAFAAVPLKTIRDLGLDPERVNVNGGAIALGHPIGATGAMLIGTVLDEL
ERRDLATGLVTMCTGGGMGTATIIERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgtcgtccatccgcaagatctgttggcgcagtgccttgccgccgccgtccagcgg
gtgggcttcgaccccgccgaggtcgacgatgtgatcgccggcaacggcatcatggcgggt
gagcacggggacgacatcgccaggctgtcactgttgctggcgggctggccgcagagtgtt
cccgggatgactctgaaccgattctgcggatccgggcagcaggccgtcacggtcgcggcc
gcaggcatcgcgagcggccagcaagagttggtggtcgccggtggcgtggagtcgatgtcg
cggtggaacgtcactgtgggcgccccgacgatcgatggcgcgaacccggcctttcggcag
ctgtatccgactgtgccacagggtatatcggctgatctgatcgcatcgctggaaggcttc
agtagggctgatgtcgatgcgttcgcggtgtccagccaggaccgtgcggcagcggcgatc
gggggcggatattttgacggctcggtgatagcggtgcgcaacggtgacggcgacattgtt
gccgatcgcgacgaacacccgcgcccgggaacgacattggagaaactgggtgggctgccg
gccgcctttgaacgcatgggtgcggctcgactcgagggtgaaagcctcaccttcgatgag
atctgcttgagtcgttaccccgatgtggaacgcatcgaccatgtccaccacgccggcaac
tcctcgggcgtcgtcgatggcgccgcggtggtgacagtggcctccgctgggtgggtcaaa
gcccacggggtgacgccgcgtgcgcgcattcgcgccgccgcggcgatcggcagcgagccg
atcatcatgctcaccgcacccggcccggctgccgagcgctgcctggccaaggccgggatg
gccgtcggcgacgtcgacctatgggagatcaacgaggcgttcgccgcggtgccgctcaag
acgatccgcgatctcggcctcgatccggagcgggtcaacgtcaacggcggcgccatcgcg
ctcggacacccgatcggggccaccggcgccatgttgatcggcaccgtgctcgacgagttg
gagcgccgcgacctcgccaccggcctggtcaccatgtgcaccggtggcggtatgggcacc
gcgacgatcatcgagcgggtctga

DBGET integrated database retrieval system