KEGG   Mycoplasma sp. (ex Biomphalaria glabrata): ASO20_00560Help
Entry
ASO20_00560       CDS       T04239                                 

Definition
(GenBank) hypothetical protein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
myg  Mycoplasma sp. (ex Biomphalaria glabrata)
Pathway
myg00770  Pantothenate and CoA biosynthesis
myg01100  Metabolic pathways
Module
myg_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:myg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ASO20_00560
Enzymes [BR:myg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ASO20_00560
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ASO20_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ALV23168
UniProt: A0A0U3PSF0
Position
complement(173857..174144)
Genome map
AA seq 95 aa AA seqDB search
MKKILIIASGSVALVKTPTLIQLLKTRYEIRVITTDCVKNNYKNYSSLNSIKEISNLESY
PQSHIENAKWADLILVVPAIAKKLELAKLICKELN
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaattattgctagcgggagtgttgctctagtaaaaacacctactctt
attcaactacttaaaacaaggtatgaaattagagtaataacaacagattgcgttaaaaat
aactacaaaaattattcttccttaaactcaattaaagaaatttcaaatctagaatcatac
ccacaatcacatattgaaaatgctaaatgagcagatttaatactagtcgttccagccata
gcaaagaaattagaattagctaaattgatttgtaaggaattaaattaa

DBGET integrated database retrieval system