KEGG   Mycoplasma sp. (ex Biomphalaria glabrata): ASO20_01525Help
Entry
ASO20_01525       CDS       T04239                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
myg  Mycoplasma sp. (ex Biomphalaria glabrata)
Pathway
myg00450  Selenocompound metabolism
myg00970  Aminoacyl-tRNA biosynthesis
myg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ASO20_01525
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ASO20_01525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myg01007]
    ASO20_01525
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:myg03016]
    ASO20_01525
Enzymes [BR:myg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ASO20_01525
Amino acid related enzymes [BR:myg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ASO20_01525
Transfer RNA biogenesis [BR:myg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ASO20_01525
 Prokaryotic type
   Other AARSs
    ASO20_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ALV23330
UniProt: A0A0U3MWR1
Position
complement(351114..352496)
Genome map
AA seq 460 aa AA seqDB search
MTGSDEHGQKIEKQAQLLNLTPQQLVDKNVENFKILWKKLNINYDQFIRTTSQRHKDIVV
KVYELLKNKELIYKDFYRGNYCIPCETYYQKKELINEKFCPICGKETQLLELESFFFKMS
SFEDWITNVIKNNEIIILPENRKSELLNNFLGGQFTNLSITRNNYTWGINVESNHVLYVW
IDALFNYISALGFLTNDDALYKKYWDNDDVERIHIIGKEITRFHCIYWPILLHSLELKLP
SKIIAHGWITVNNEKMSKSLGNVVNPLELIDKYGADSLRYFLMKSNKIGNDFSFDIENFI
FVINSDLANNVGNLVSRTFNMIQKYNSGMVPKFKNKEKLNDDIEFKINEAFNEFKNFNSN
KAINIVQEICEFLNKLIENEKPWELFTRSDLEKLNWILTTLVVSINWIFHFLSAILTDGY
LEYNKYIGWKNESLSNLINWNSLDEKEVKKPNPIFRRFEK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaagcgacgagcatggtcaaaaaattgaaaaacaagctcaactactaaattta
acgccacaacaattagtcgataaaaatgtcgaaaattttaaaattttatgaaaaaaatta
aacattaattacgaccaatttattagaacaacttctcagcgtcataaggatattgtggtt
aaagtttatgaattactaaaaaataaagaactaatatataaagatttttatcgcggtaat
tactgcattccttgcgaaacttattatcaaaaaaaagaattaattaatgaaaaattttgt
cctatttgcgggaaagaaactcaacttttagaattagaatcttttttctttaaaatgagt
tcatttgaggattgaattacaaatgtgattaaaaataatgaaattattattctcccagaa
aatcgaaaaagcgaattattaaataattttttaggagggcaattcaccaatttatctata
acgagaaacaattatacatgaggaattaatgttgaaagtaatcatgtattgtatgtttga
atagatgcattatttaattacatttcagcactaggttttttaacaaatgatgatgcttta
tataagaaatattgagataacgatgatgttgaaagaattcacattatcggaaaagaaatc
acaagatttcattgtatttactgaccaattttacttcacagtttggagttaaaattacca
tcaaaaataattgcacacggatgaataactgtgaataatgaaaaaatgtcaaaatcacta
gggaatgtcgttaatccactagaattaattgataaatatggtgcagattcactaaggtat
tttttaatgaaatctaataaaataggtaatgatttttcttttgatattgaaaattttatt
tttgtaataaatagtgatttagctaataatgtaggcaacttagtatctagaacttttaat
atgattcaaaaatataattctggaatggttcctaaatttaaaaacaaagaaaaactaaat
gatgatatagaatttaaaattaatgaagcatttaatgaatttaaaaactttaattcgaat
aaagctatcaatatagttcaagaaatttgtgagtttttaaataaattgattgaaaacgaa
aagccatgagaattatttacaagaagtgatttagaaaaattaaattgaatattaacaact
cttgttgtttcgataaattggattttccactttttaagcgctattttaactgatggttat
ctagaatataataaatatataggttgaaaaaacgaatcactatctaatttaataaattga
aatagtttagatgaaaaagaagtaaagaaaccaaatccaatttttaggagatttgaaaag
taa

DBGET integrated database retrieval system