KEGG   Mizuhopecten yessoensis (Yesso scallop): 110441500Help
Entry
110441500         CDS       T05079                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myi04040]
    110441500
Ion channels [BR:myi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110441500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DuoxA DsbD DUF2232 L_HMGIC_fpl DUF4395 Sre HcyBio Clc-like DUF4064 FtsX DUF1772 Amastin SLAC1
Motif
Other DBs
NCBI-GeneID: 110441500
NCBI-ProteinID: XP_021340342
Position
Unknown
AA seq 169 aa AA seqDB search
SIGTPCLTVSDFGDPGRIEGQETSFAIIKSNRVAAMIPVISLILLTIAAVLSVLGNLRQD
IKTLISAVIYILAGLSLAVGLILYISVINDEVGHRMKEKDKEEVSFSYTYGWSFYFAGTA
FLCAMLSAVIHVSLYLQRNSRKEEMVRVIPGLDELLESDTGTANPTVII
NT seq 512 nt NT seq  +upstreamnt  +downstreamnt
aaagcattggtacgccatgcttgacggtgagcgactttggagacccgggccgtatcgagg
ggcaggagacgtcatttgccattattaagtccaacagagtagcggcaatgatccctgtga
tatcactgatactcctcaccatagcggcggtcctcagtgtgctaggcaacctccggcagg
acatcaagacactcatctccgctgtcatctacattctagcgggtctaagtctagcagtgg
gcctgattctgtacatctctgtgatcaatgatgaggtaggccaccgaatgaaagaaaagg
acaaagaggaggtttccttcagctatacgtacggatggtcgttctatttcgccggaaccg
ccttcctgtgtgccatgctgtcggcggtcattcacgtgtcactctaccttcagaggaact
cgcgcaaggaggagatggtccgggtcatcccagggctagacgaactgctggaaagcgaca
cgggcaccgctaacccaaccgtcatcatctga

DBGET integrated database retrieval system