KEGG   Mizuhopecten yessoensis (Yesso scallop): 110443430Help
Entry
110443430         CDS       T05079                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myi01001]
    110443430
Enzymes [BR:myi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110443430
Protein kinases [BR:myi01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   110443430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Choline_kinase VF530
Motif
Other DBs
NCBI-GeneID: 110443430
NCBI-ProteinID: XP_021343327
Position
Unknown
AA seq 359 aa AA seqDB search
MMMGDNETRNLKPKKYPISDDYRITGAVLGLGINGKVVECFSKKTNQKCALKVLRDVPKA
RREVDLHWRASGCKHIVAITDVYENAYSGQKCLLVVMECMEGGELFNKIQERADSAFTER
EAAAIIRDIAKAIHYLHSLEIAHRDLKPENLLYSDKTVNGTLKLTDFGFAKAITTDFKML
QTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGAAISPGMKKRIR
NGQYEFPSSEWKNVSKDAKDLIQGLLKTVPEERFSIEQVMRNKWISDHITVPQTPLCSAM
ILKEDSENWAEVQEEMTNALATMRVDYDMCQIKNLDETDNPILKKRKKRSTAEPMYNQS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgggagacaacgaaactaggaatttaaaaccaaaaaaatacccgataagtgac
gattacagaataacaggggccgttttgggccttgggataaatggaaaagttgttgaatgt
ttttctaaaaaaacgaatcagaagtgtgcgttaaaggtgttgagagatgtgccaaaagca
agaagggaggtggacctccactggagagcatcaggctgtaaacacattgtagcaattaca
gatgtgtacgagaatgcctacagtggtcagaagtgcctgttggtggtcatggaatgtatg
gaaggaggggaactcttcaacaaaatacaagaaagagccgattcagcatttacagaaaga
gaggcagctgctatcattcgtgacattgccaaagccatccactatctacattccttggaa
atagcccaccgagatctaaagcctgaaaacttactgtactcagacaaaactgttaatgga
acattgaaattaacagattttggttttgccaaagcaatcacaacagactttaagatgtta
caaactccttgctacacaccctattatgttgccccagaggtacttggtccagaaaagtac
gacaaatcctgtgatatgtggtcgttaggtgttatcatgtatattttattgtgtgggtac
ccaccattctacagtaatcacggagcagctatttcacctggtatgaagaagagaatcaga
aatggacagtatgagtttcccagttcagaatggaaaaatgtgtcaaaagatgcaaaagat
ttaattcaaggcttattaaaaactgttcccgaagaaaggttttcaatagaacaggtcatg
aggaacaaatggatatcagatcacataacagtgccccagacacctctctgctcagcaatg
atcctcaaggaggattcagaaaattgggcagaggtacaggaggagatgaccaatgctttg
gcgaccatgagagtggactacgatatgtgccagataaagaacttagatgagacagataac
cccattttaaagaagcgtaagaagaggagtacagcagaaccaatgtataaccagtcttaa

DBGET integrated database retrieval system