KEGG   Mizuhopecten yessoensis (Yesso scallop): 110445921Help
Entry
110445921         CDS       T05079                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:myi01002]
    110445921
Enzymes [BR:myi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110445921
Peptidases [BR:myi01002]
 Serine Peptidases
  Family S33
   110445921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 LIDHydrolase FSH1 Esterase Esterase_phd Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 110445921
NCBI-ProteinID: XP_021346464
Position
Unknown
AA seq 344 aa AA seqDB search
MAALVPEFAMSLMIYPVLVTTATVTAATLLVYLNRPVLVVQMYMKFAVLFSGMKIQYVKL
GDLTLCYGERGRKRPDKSSILLLHGFSADKFMWVPLVKNLTDYHVIALDLPGHGDSDIPS
EGEDISFNGQVSRVREFVEAVGLDKTPFHMVGMSMGGSIAGLYTAKYPDQIERLSMMCPA
MKTPIDSEVSIKIREIMETQDDETILRECPFIPKNPEEMKYMLGFAQFYKPNFFFTNKIL
QGAVEMRKPNNIFFFRLFKSLASWEYAAILENTAHKITVPSQLIWGEEDQVIDVSGVKVL
QEKLPNCQSVDIISRCGHAINLDRPGSKTKAILKFRGELKTKQS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctgcattagtcccagaatttgcaatgtctttgatgatttaccctgtacttgtcaca
acagctacagtgacagcggcaaccctcctcgtctacctcaaccgaccggttcttgtggtt
cagatgtacatgaaatttgcagtgttgtttagtgggatgaagattcagtatgtaaaatta
ggagacctcacattatgttacggagagagaggcaggaaacgacctgacaagtcttctatt
ctccttctgcatggattctcagctgacaagtttatgtgggtgccactggtgaagaatctt
acagactaccatgtgattgcactggacttgccaggacacggggacagtgacattccctca
gaaggtgaagacatttcattcaatggacaggtgtctagggttcgcgagtttgtggaggct
gttggattggacaagacaccattccacatggtgggaatgtctatgggtgggtctatagct
ggcctgtacactgccaaatacccagaccaaatagaaaggctttctatgatgtgtccagca
atgaagacacccatagacagtgaagtttccataaagattcgggagattatggagacacag
gatgatgaaaccatcctcagagaatgtccatttataccaaaaaaccctgaggagatgaag
tatatgctaggctttgctcagttttacaagccaaatttcttttttacaaacaagattcta
cagggtgctgttgaaatgagaaaaccaaacaacatttttttctttcgtctgttcaagtcc
cttgccagctgggaatatgcagcaatattagagaacacagcccacaagatcactgtacca
agccagcttatatggggcgaggaagaccaggtgatagatgtatcaggagtgaaggtactg
caagaaaagctgccaaactgccaatctgtggacatcatttcccgctgtggtcacgccatc
aacctggatagaccaggctcaaagaccaaagccattttaaaatttaggggcgaacttaaa
accaagcaaagctga

DBGET integrated database retrieval system