KEGG   Mizuhopecten yessoensis (Yesso scallop): 110446832Help
Entry
110446832         CDS       T05079                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myi01009]
    110446832
Enzymes [BR:myi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110446832
    3.1.3.48  protein-tyrosine-phosphatase
     110446832
Protein phosphatases and associated proteins [BR:myi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    110446832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT CDKN3 Myotub-related Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 110446832
NCBI-ProteinID: XP_021347824
Position
Unknown
AA seq 388 aa AA seqDB search
MPECGDIDVLTPTSLMTNTILQGGRRRLQLSLDFSSITDSEDFHVPKKLCKLESMSVSLT
GPLKLNSLAPTPASWRTIQPQELAARLNKVHKSCLLLDCRSFISYNVTHIQGAVNVNCCD
RFNRKRLQQGKVTLIDLVNSKEAKDQFKRRGSKEVILYDDGTKDLHQLPTDSSLYLVVSS
LLREGKEVLVLQGGLQAFRCQYTDLCHSGVKIVDSRPLYSPTTGIIEPQIEAAEATQILP
FLYLGNERDAANYKKLTDLDITYVLNTTSTVPKHFEDQGITYKRIPASDSGAQNLQQYFE
EAIQFIEEARQKEARVLIHCHAGVSRSATITIAYLLTRSSLSLMDAYRFVKGRRSIISPN
FNFMGQLMEYEQSLNSGSCSRVLTPKIV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagtgtggtgatatagatgttttaaccccaacctccctcatgaccaacaccata
ttacaaggaggaagacgaagattacaattgtctttggatttttcatcgataacggattct
gaagattttcatgtgccgaaaaagctctgtaagttggaatcaatgagtgtttcattaacg
ggacccttaaaattgaactctttggcccctacaccagcctcctggcggactatacagccc
caggaactggctgctagactcaacaaagttcacaaatcgtgtcttttgttggactgtaga
tcttttatctcttacaacgtgactcatattcagggtgctgtcaatgtcaactgttgtgac
agattcaacagaaaacggcttcagcagggaaaagttactctgatagaccttgtgaattct
aaagaggccaaggaccaatttaaacgtcgagggtcaaaggaagtgattctttacgacgat
ggaaccaaagacctgcatcaacttcccacagacagttctctgtatctcgtcgtctcgtcc
ctactgagagaaggcaaggaggtgctggttctccaaggaggactccaagccttccggtgc
caatacactgacctttgtcacagtggggttaaaatcgtcgactctcgtccactctattct
ccgaccacgggaataatcgaaccccagatcgaggctgccgaagcgacccaaatattgcct
tttctatatctaggaaacgaacgtgatgcggcgaactacaagaagttaaccgaccttgat
atcacatacgtgctgaacacgacctcgaccgtgcccaagcacttcgaagaccaaggcatt
acttacaagcgcatcccggcctcggatagtggggcacagaatctccagcagtacttcgag
gaagctatccaatttatagaggaagctcgtcagaaagaagcacgtgtcctcattcattgt
cacgcgggcgtctcgcgctctgccaccatcactattgcctacctactcactcgatcatca
ctgagcctcatggatgcataccgttttgtgaaaggacgccgatccatcatttctcctaac
ttcaacttcatgggccagctcatggaatacgaacagtccctcaacagcgggtcatgctcg
cgggtgctaactcccaaaattgtgtag

DBGET integrated database retrieval system