KEGG   Mizuhopecten yessoensis (Yesso scallop): 110448875Help
Entry
110448875         CDS       T05079                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:myi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110448875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:myi04030]
    110448875
G protein-coupled receptors [BR:myi04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110448875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 110448875
NCBI-ProteinID: XP_021351031
Position
Unknown
AA seq 332 aa AA seqDB search
MENETVNLSCRPEPKPEQILGDGVVSTLVIICLSSLPVLTILGNLLVIIIIVRRSNFRQK
ANVFVVSLAIADIAVAIFVMLFSILQEVSNMAWLSDPNICLMAWSFDVMFTTTSILHLMC
MTIDRYVAICLPFKYHDLISQTCVATLLMLCWSLPAVISFGLIFGKVHMIGIEEYYSCSS
QCQFRVNAYYAVICSVISFYIPSIFMLVLNFKIFWNVRVRTRQLRQMTDGMAVQSKQKEH
FLMREASVARTIAIMLGCFLICWLPFFVFNVIDPLMNYTISEVLWKIVTWFGYVNSTINP
YLYYFRNRKNRPCIYKSNVMMKRSASCKGHQV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgagaccgtgaatctaagttgccggcccgagcctaaaccggaacagatcttg
ggagatggcgtggtttcgacacttgtaatcatttgcctttcaagccttccggtattgaca
atattaggaaacctcttggtcatcatcatcattgtcagacgcagtaacttccggcagaaa
gccaatgtgtttgtagtgtctttggccattgctgacattgctgtagcaattttcgtgatg
ctgttttccatactgcaggaagtgagtaacatggcgtggctaagtgatccaaatatctgt
ctcatggcttggagttttgatgtgatgtttaccacaacgtcaattctacatttgatgtgt
atgacaatagaccggtatgtggcgatatgtttgccttttaagtatcacgatctgataagt
caaacgtgtgtggcaaccctactgatgctctgctggtcactgccggccgtaatctcattt
ggattaatatttggtaaagttcacatgatcggaatagaagaatattattcttgttcctct
cagtgccagttcagagttaatgcctattatgctgtcatatgctctgtcatttcattctac
attccgtcaatattcatgttagtgctaaattttaagattttctggaatgttcgagttcga
acacgacaacttcgccaaatgacggacggtatggcagtgcagtctaaacaaaaagaacac
ttcctcatgagggaggctagtgttgccaggacaatagccattatgctggggtgttttctc
atatgttggttgccattttttgtcttcaacgtcatcgacccacttatgaactatacgatc
agtgaggtgctttggaaaatagtgacttggttcggttatgtaaattcaactataaatccc
tatttgtattattttcgtaacagaaaaaatcggccatgcatatataagtctaatgtgatg
atgaaacgaagtgcaagttgtaaaggtcatcaggtgtag

DBGET integrated database retrieval system