KEGG   Mizuhopecten yessoensis (Yesso scallop): 110449251Help
Entry
110449251         CDS       T05079                                 

Definition
(RefSeq) guanylyl cyclase GC-E-like
  KO
K22600  guanylate cyclase 2G [EC:4.6.1.2]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00230  Purine metabolism
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110449251
Enzymes [BR:myi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110449251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBP_like_2 Pkinase_Tyr Pkinase Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 110449251
NCBI-ProteinID: XP_021351678
Position
Unknown
AA seq 1157 aa AA seqDB search
MFCSRAVPYIVLCLCLCRCVAAVAYVRGKGASFPHEVYKEWRSAYRLYRSAHVTLEMSYD
AIGSGNGKKAIQENVDIEYAGSDSLLSDSTIASHPDLVLFPIMAGAVMLGYNIPDLGGRL
VLTRSTIVGIFNGTYTWWNDTIFTATNPGLNMPQKEIIVIARADKSGTTSLFTEALGAFS
PNWKQQYGMFSKGYDSVNNVPYHWDPTVINYYGQQNRGVSGLILSFRNSIGYLSVADIYE
ADINAATIVNKAGRLIDANSSTVQSAMDYFSDRNTNLTFSLADAGSESAYPIAGFTHIII
YKTKMKNCQSSKELIRYLYWAMTDKDQRITCDRKGMSPLSTSMVQRIKSVVLTHVTCHGA
NVWAMVESDIAAENKEVQQWILPVSITIPIVSLCILALCSFIIKQRLHIQKMIDNDEWFI
PIEDILFYFDGRDRSSMNSRIADRPSIISNASVRDIQDDDILIRQIIQWPGKYRGSQIGI
RLIEVTELNQLTRQTKHQLLLMKNRISHINVVRMFGLTEVDDKKYLIGDYCSKGRMTNVL
RDDKFNLSNDFKCTLAGDVANGMHFLHSNDIIHGFLRSDVCLIDARWQVKICDWEYGTLL
SSQAPNISPILVMRKKSDKDLGTHDIAFKNFWVSPEILRSDFKLNPTKESDVYSFAIILQ
EIFTREEPYAEHADSLTPTEVIRAITLNTLRPEHSEETPVNIRQLMEICWNDHAISRPSF
EQVLKLLKRANPLKRTVVDSMMSSMEEYIAHLEERIEEKNAELKVSNNKLETTLSGLMPE
FIAKVISKGKSVRPMMFPAIAVVILDISHSSVNFENLNPRDVIAFINELCFEIDLLARKY
SVYTAPVSGCSLALVHGLESSKIKPDEMCISMVNLCFDILSHEEIGRLTKSMENKFVFRL
GAHVGPAITGLSGTTSPSYVVFGDCIDVSQALARTAPVTCLHVHVSENVWCAIKRSKRFE
ASTAGELSVKGRIFVTYTITRIQERVKYATSEDSGVGGEPHSQALTESYEPNKTCDPSVN
MIEQESGSNAVAQNGILNDKNTVHQSQDELEKHCRDMVVVQMISDSIKHPEAFRDKLRSR
ARSKHHHNYHKRHSSLQKHRSHDLNNGSDTLESITSLQSEIKPMDTSNFGVPVSKQFVPV
KRKRKRKFFLNNIYPEN
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgttttgttcacgagcagtaccatatatagtgttgtgcctgtgtttgtgtagatgtgtg
gctgcagtcgcgtatgtcagaggaaagggagctagcttccctcacgaggtctacaaagaa
tggagatctgcgtaccgtctttacagaagtgcacatgtcacactggaaatgtcatatgat
gcaatcgggagtggaaacgggaagaaagctatccaggaaaatgtggacattgagtatgct
ggttccgactccttgttgtccgattccaccattgccagccatcccgaccttgttttgttc
cccattatggcaggtgcggtgatgctaggctataatattccagacttgggcgggcgtctt
gtgctcacgagatcaactattgttggcattttcaacggcacttacacttggtggaacgac
accatatttaccgccaccaaccccggccttaacatgcctcagaaagagatcatcgtcata
gcaagggcagacaagtctggtactacttccctcttcactgaggcactcggtgctttcagt
cccaattggaaacaacaatacgggatgttttcaaaaggatacgattctgtgaataatgtc
ccatatcattgggatccgaccgtcatcaattattacggtcagcaaaacagaggggtgtcg
gggttgattctgtccttcagaaattcaatcggttacttgtcagtagctgatatttatgag
gcagacatcaatgccgcaacaattgtgaacaaagcaggtagactgatcgacgctaactcc
agtacagtacagagcgccatggattacttttcggatagaaatactaatctaacatttagc
ttagcagatgccggctctgagagtgcatatccgatagctggatttactcacatcatcatt
tacaagacaaaaatgaaaaactgtcagtcttctaaagagttaatacggtacctttattgg
gcaatgaccgataaggaccaaagaatcacgtgtgacaggaaaggtatgtcgccattgagt
actagcatggttcagcgcataaagtcggtcgttttgacacatgtgacctgtcacggcgca
aatgtgtgggctatggtagagagcgatatagcggctgaaaataaggaggtacaacagtgg
atcctacccgtgtcgatcacaattcctatagtgtcactgtgcatattagcactgtgttct
tttattatcaagcagcgcttgcacatccagaaaatgattgataatgacgaatggtttatt
ccaatagaggacatccttttctactttgacggaagagacaggtcgtccatgaactcgcgt
atcgctgatcgaccttctataatctccaacgcgtccgtccgagacattcaggacgatgat
atccttatcaggcagattatacagtggccaggaaagtatcggggaagtcaaatcggcatt
cgattgattgaggtcacggaactgaatcagctgactcggcagaccaaacatcaactgttg
ttgatgaaaaacagaatctcacacatcaacgttgtaagaatgtttggtctgacggaggta
gacgataaaaaatacttaattggagactactgcagtaaaggacgaatgacaaacgttctt
cgcgatgacaagttcaacttgtctaatgatttcaaatgtacgcttgcaggagacgtggca
aacggtatgcatttccttcattccaacgatattatacacggttttcttcggtctgatgtt
tgtcttatcgacgcgaggtggcaggtgaaaatttgtgattgggaatacgggacgcttttg
tcatcacaagcaccaaatatatccccaattttggtcatgcgtaaaaaatcagacaaagat
ctaggaacacatgatatagctttcaaaaacttttgggtcagtccggaaatattgaggtct
gattttaagctcaacccaacaaaagaatcagacgtgtatagctttgctatcattctgcaa
gaaattttcactcgggaagaaccgtatgcagaacatgcagactctttgacaccaacggaa
gtgataagggcgataactctaaacacccttcgcccagaacatagcgaagaaactccagtc
aacataaggcagctcatggaaatatgttggaacgaccacgccatatcccgtccttcattc
gagcaggttctaaaattactcaaacgtgcaaatcctctgaaaaggacggtggtagacagc
atgatgtcttcgatggaagagtacattgctcatctagaggagagaattgaggagaaaaac
gccgagctcaaggtatctaataacaaattagaaacgacactctctggtttgatgcctgaa
ttcattgctaaagtaatatcaaaaggcaaatctgtacgaccaatgatgtttccagccata
gcagtggttatcctcgatatttcccattcctcagttaacttcgagaatcttaatcctcgc
gacgtcattgccttcatcaacgaactgtgctttgaaattgacctgcttgcacgaaaatat
tctgtctatactgcgccagtgagtggttgttctctcgcgcttgtgcatggactggagtcg
tccaagattaaacctgatgaaatgtgcatttcgatggtaaacttatgctttgatatactg
tcacacgaggaaattggcagactgacgaagtcaatggaaaataaattcgtctttcgtctt
ggtgcccacgtcggacctgccatcacaggactttctggaacaacgtcaccatcgtatgtg
gtgtttggagactgtattgatgtaagtcaagctctcgcacgcacagcgcctgtcacgtgt
ttgcacgtacatgtatccgagaacgtgtggtgtgctataaaacgtagcaaaaggtttgag
gccagtactgcaggtgaacttagtgtcaagggaaggatctttgtcacctatacaattaca
agaatacaggaacgagtaaaatacgctacctctgaggattctggcgttggaggagaaccg
cactcccaggcattgacggaaagttatgagcctaacaaaacctgtgatccttcggttaat
atgatagaacaagagtcaggatctaacgcagtagcacaaaatggaatactgaatgacaag
aacactgtgcatcaaagtcaggatgagcttgaaaagcattgtagggacatggtggtcgtt
caaatgatatctgactcaatcaaacatccggaggcgttcagagataaattacgatcacgc
gcaaggagtaaacatcatcacaactatcacaaaagacattccagtttacagaaacaccgg
tcacatgacttaaacaatggttcggacacactagaaagtataacttccctccaatcggag
atcaaaccaatggacacgtcaaactttggagtaccggtgtccaagcaatttgtaccggtg
aaaagaaaaaggaaacggaaattctttttgaataatatttaccccgaaaattga

DBGET integrated database retrieval system