KEGG   Mizuhopecten yessoensis (Yesso scallop): 110453033Help
Entry
110453033         CDS       T05079                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00020  Citrate cycle (TCA cycle)
myi00640  Propanoate metabolism
myi01100  Metabolic pathways
myi01200  Carbon metabolism
Module
myi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110453033
   00640 Propanoate metabolism
    110453033
Enzymes [BR:myi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110453033
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110453033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 110453033
NCBI-ProteinID: XP_021357524
Position
Unknown
AA seq 326 aa AA seqDB search
MAATSRVFSPIVVAARVGIRHCYTGTRGNLAINKNTKVICQGFTGKQGTFHSQQAIEYGT
QMVGGVSPGKGGQIHLGLPVFNSTKEAMEATNADASVVYVPPKMAGQALVDAIDAEVPLI
VCITEGIPQQDMVRVKHKLLRQNKSRLIGPNCPGIIRPGECKIGIMPGHIHQKGKIGIVS
RSGTLTYEAVHQTTQAGLGQTLCVGIGGDPFNGTNFIDCLEVFLNDPATEGIVLIGEIGG
QAEEKAAEYLKNFNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAEEKIESLKS
AGVHVSMSPAQLGTTMLQAMGMTQES
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccagcagagtgtttagcccaatagtggttgctgccagggttggtataaga
cactgttacactggcacaagaggcaatttggccatcaacaaaaacacgaaagtcatatgt
cagggatttacagggaaacagggtacttttcatagtcagcaagctatagaatatggaaca
caaatggttggtggtgtctcacctggtaaagggggccaaatccatctgggattaccggta
tttaactctacaaaagaggcgatggaagcaactaatgctgatgcttcagtagtgtatgtg
cctcccaaaatggccggccaggccctggtggatgctatagatgctgaggttcctctcatt
gtctgtatcacagaaggtatcccacaacaagacatggtccgggtaaaacacaaacttcta
cgccagaataaatctcgtctcatcggcccaaactgtcctggaataattaggcctggcgag
tgtaaaataggaattatgccaggtcacattcatcaaaaaggaaaaataggtattgtgtcg
cgttcaggcactcttacctacgaggccgtgcaccagaccactcaagctggactaggccaa
acgctgtgtgttggtattggtggtgatccatttaatggtacaaatttcattgactgcctc
gaagtcttcctgaatgaccctgccacagaaggtattgtgctgattggtgagattggaggc
caggcagaagaaaaggcagctgaatatcttaaaaacttcaattctggacccaacgctaag
cccgtagtgtcttttatcgctggcctgacagcgccacctggccgtcgcatgggtcatgca
ggagctatcattgccgggggcaagggaggtgcagaagagaaaattgagtccctgaaatct
gcaggtgttcatgtgagcatgtctcctgctcaactaggcaccacaatgctccaggcgatg
ggaatgacccaagaatcctag

DBGET integrated database retrieval system