KEGG   Mizuhopecten yessoensis (Yesso scallop): 110454018Help
Entry
110454018         CDS       T05079                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:myi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110454018
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:myi03041]
    110454018
Enzymes [BR:myi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110454018
Spliceosome [BR:myi03041]
 Complex C
  Other components
   Step II factors
    110454018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 ABC_tran AAA_16 PhoH Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 110454018
NCBI-ProteinID: XP_021359000
Position
Unknown
AA seq 1241 aa AA seqDB search
MNELQKLEHLSLVSKVCTELDNHLGLNDKDLAEFIISLSEKNDTFDAFKKVLSENGAEFS
DSLIANLLRLIHKMKPKPREKEATDDSYKENQRDEDTTLKRKLYPGLALANDQQSRKLLE
DIKEEEMEETDDIKKEDTEVADDMMGELMALMANPPPDNQSDDKPKEHKSRHSRSRSRER
DRKRSRSRERDRKRHKHNRRSRSRSPRDRKRSRSRDKRRDRSRSNDRDRKHRRRSRSRSR
ERQSKYYRDEEDRKDRYRGGKSKREQGSDDEEIPMEPVVGRIFKGRVTTIMQFGCFVQLE
GLRKKCEGLVHISQLRREGRVTKVSDVVQRGQKVKVKVLSFTGSKTSLSMKDVDQDTGED
LNQERTRSLLGGELKDESEASRNPDRPSTLPMMDLPETDKTQDKKRVQRISSPEKWEIKQ
MIAANVIDKSELPDFDEDTGLLPKEEDSDEDVEIELLEEEPPFLSGHGRAGIDLSPVKIV
KNPDGSLSQSAMMQNALQKERRELKQVQREAEMGSVPAGLNNHWIDPMPEAEGRQLAANM
RGIGMTPNDIPDWKKHITGGQKASYGKKENKSLLEQRQGLPIYKLKEELVKAVSDNQVLI
VIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYT
MRFEDCTSPETKIKYMTDGMLLRECLIDPDLLQYAIIMLDEAHERSIHTDVLFGLLKEAV
KKRKELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTYPVEVLYTKEAETDYLDASMITVM
QIHLMEPPGDVLLFLTGQEEIDTACEILYERMKALGPEVPDLIILPVYSALPSEMQTRIF
EPAPPGSRKVVIATNIAETSLTINGIYYVVDPGFVKQNVYNSKTGMDQLIVTPISQAQAK
QRAGRAGRTGPGKCYRLYTERAYRDEMLATNVPEIQRTNLASTVLSLKAMGINDLLAFAF
MDAPPMQTLISAMEQLHALTALDDEGLLTRLGRRMAEFPLEPMLSKMLIMSVHLACSDEI
LTVVSMLSVQNVFYRPKDKQAMADQKKAKFHQSEGDHLTLLSVYNSWKNNRFSSPWCYDN
FVQIRTLKRAQDVRKQMLGIMDRHKLDVVSCGKNTARVQKAICSGFFRNAAKKDPQEGYR
TLVDSQVVYIHPSSALFNRQPDWVIYHELVLTTKEYMREVTAIDPKWLVEFSPKFFRFAD
PTRLSKHKKQQKIEPLYNKYEEANSWRISRAFKKVHTKVTF
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacttcagaagctcgagcacctgtccttggtgtctaaagtctgtacggagctg
gacaatcacttggggcttaatgacaaagatctagctgaatttatcatatccttatcggag
aagaatgacacctttgatgctttcaagaaagtcctttcagaaaatggagcagaattttct
gactctctgattgccaacctgctgaggttgatacacaagatgaaaccaaaaccacgagaa
aaagaggcaacagatgacagctacaaggaaaaccagagagacgaggacacaaccctgaag
aggaagctgtatccaggattagctttagcaaatgaccaacaaagcaggaaattgttggaa
gatattaaagaggaagaaatggaggagactgatgatataaagaaagaagacacagaagta
gcagatgacatgatgggtgaattgatggcccttatggctaaccctccgcctgataatcaa
agtgatgacaaacctaaggaacataaaagcagacatagtcgcagtagaagtcgagagcga
gacagaaaacgtagccgcagtagagaacgtgacaggaaaagacacaaacacaatcgtcgg
tcaagaagtcgatcacctagagacagaaaacgaagtcgtagccgtgacaagcgacgggac
agatcaaggtcaaatgaccgagataggaagcacagaagacggtcaaggagtcgaagtagg
gagagacagagtaaatactatcgagacgaagaagacagaaaggaccgatacaggggaggg
aaaagtaagagagagcaggggtcagatgatgaagagattccgatggagcctgttgttggc
aggatattcaagggaagggtgacgactattatgcagtttggttgctttgtacagcttgaa
ggtcttaggaagaaatgtgaaggacttgttcatatatcacagctgaggagagagggacga
gtgacaaaggtcagcgatgtggtccaacgaggtcaaaaggtcaaggtcaaagtgctgtca
tttactggaagtaagacaagtctttcaatgaaggatgtagaccaggatacaggggaggac
ttgaaccaggagagaacaaggtcactgcttggtggagagttaaaggatgaaagtgaggct
tctcgtaatcctgaccgcccgtccactctaccaatgatggatctgcccgagacagacaaa
acacaggacaagaagcgtgtccagcgaatttcttcaccagaaaagtgggaaatcaaacag
atgatagctgctaatgttattgacaaatcagagctacccgactttgatgaggatactggt
ctacttccaaaagaggaggattcagatgaggatgtggagattgaactgttagaggaggaa
cctcctttcctcagtggacacgggcgagcaggaatcgacctgagtcctgtcaaaattgtc
aagaatcctgatggttcactgtcccagtccgccatgatgcagaatgcccttcagaaagag
cggagggagttgaaacaggttcaacgagaggcagaaatgggcagtgtcccggcaggtctc
aacaatcactggatagaccccatgcctgaagctgaaggacgacaacttgctgcaaacatg
aggggcattggaatgactccaaacgacattccagactggaagaagcatatcacaggggga
cagaaggcgtcttacggtaaaaaggagaataagtctttactagaacagaggcagggtcta
cccatctacaaactcaaggaggaacttgtcaaggctgtcagtgacaaccaagtgttgatt
gtgattggggagacagggtcagggaagacaactcagatcacacagtacctggccgaagct
gggtacacaacacgtgggaaaataggatgtacccagccccgtcgtgtagccgctatgtct
gttgccaagagagtatcagaggagttcgggtgtcgcctgggtcaagaggttggttacacg
atgcgttttgaggactgtacgagcccagagacaaagattaagtacatgacagatggtatg
ttgttgagagaatgtctgatagatccggacctcctgcagtacgccatcatcatgttggac
gaggctcatgaacgttccatacacacagatgtcctgtttggactcctcaaggaggcggtc
aaaaaacgtaaagaactgaagctgatcgttacttctgccacgctagatgctgtcaaattt
tcacagtacttcttcgaagcacccatctttaccatccctggtcggacatacccagtggag
gtgctatacacaaaagaggctgagacagactacttggacgcttccatgatcacagtaatg
cagatacaccttatggagccgccaggtgatgtcttactcttcctcactggtcaagaagaa
attgacacggcctgtgagatcctgtacgagcgaatgaaggccctcggtcctgaagtccca
gaccttatcattctccctgtgtacagtgctcttcccagtgaaatgcagaccaggatcttt
gagccggctcctcctgggtctaggaaggtggttattgcaactaacattgcagaaacatcg
ctcacaataaacggaatttattacgttgtagatcctggatttgtgaaacagaacgtttat
aattctaaaactggaatggatcagctgattgttactccaatctcacaggctcaggctaaa
cagagagcaggccgggcaggacgaactggtcctggtaaatgttacagactatacacagag
cgagcatatcgtgatgagatgctggccacaaacgtcccggagatccagaggactaactta
gccagtactgtgctgtccctgaaggcgatgggcatcaacgatctactggcattcgccttc
atggacgctccgccaatgcagacattaatctcagcaatggaacaactgcatgctctcact
gccctggatgatgaaggtctgctgaccagacttggacgtaggatggccgagtttccactg
gagccgatgttatcaaagatgttgatcatgtctgtccatctggcatgcagtgacgaaatt
ctcacagttgtgtccatgttgtctgtacagaacgttttctacagacccaaggacaagcaa
gcaatggctgatcagaagaaggccaagtttcatcagtcagagggtgaccatctgacactg
ttgtctgtctataactcatggaaaaacaaccgcttctcgagtccctggtgctatgacaac
tttgtccaaatacgcacactaaaacgggcacaggatgtccgcaaacagatgcttggcatt
atggacagacacaagctagatgtggtaagctgtggaaagaatactgctcgggtacagaag
gccatttgcagtggattctttagaaatgctgccaagaaggacccccaggagggttatagg
acactggtagacagccaggtagtctacatacatccgtctagtgccctgttcaataggcag
ccagactgggtgatataccatgaactggtgctaacgacaaaggagtacatgcgtgaggtg
acagccatcgatccaaaatggctggtggaattttcgcccaaattcttccgatttgccgac
ccaacaagactaagcaagcacaagaagcagcagaaaattgaacccctgtacaacaaatat
gaggaggcaaactcatggaggatttcacgggctttcaagaaggttcacaccaaagtcacg
ttctga

DBGET integrated database retrieval system