KEGG   Mizuhopecten yessoensis (Yesso scallop): 110456990Help
Entry
110456990         CDS       T05079                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00010  Glycolysis / Gluconeogenesis
myi00562  Inositol phosphate metabolism
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110456990
   00562 Inositol phosphate metabolism
    110456990
Enzymes [BR:myi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110456990
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110456990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 CENP-B_dimeris DUF4708
Motif
Other DBs
NCBI-GeneID: 110456990
NCBI-ProteinID: XP_021363748
Position
Unknown
AA seq 475 aa AA seqDB search
MSSALYHVLLICTILNIDTRAYGDVRFLNKCIFSTKTPYFWIKSNDEVVTEDSEAICNGP
DKTKLTKSCVSFHINSLIRHGIRYPGLKWIKHMDEVQQKLTKAIIRPSSQSGFIEKWANP
FPNEKEHALAPSGKSELFELGKRFGQRFKMLLEVETEKVQYFVSSKERTFDSRRAFHDGL
ISIFSTDVIGDSYKVPIIDDNILRFHSGCKKYLDQIENNDTALGEYFKFKNGPEMNSVVN
DVKKRIVDDVDVIGTISGDDVQTIHQICAFELSFFGKSDWCQFFEKEDMEVIDYLNDLKH
YWQKAYGYKLSSDMSCPLVRHIFQKMDDAVNDFEDGEDFTVGLFRFAHAETLLPLYAALG
LYKDSEPLMASNFERHTNRLFRSSKIVPFAANIAFVLYECDINSDNEEEEDDSDDEDEES
IYVKLYVNEEAITIPACGEVLCRYTDVREYYSQLIDKCNFGQICEVDKIKDHDEL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgcattgtatcacgttttactgatttgtaccattttaaatatcgatacacgt
gcttacggcgatgttcgatttttaaacaagtgtattttttccacaaagacgccatatttc
tggataaaaagtaatgatgaagtcgtcacggaagattcagaagccatctgcaatggccca
gataaaacaaaactcacgaagtcctgtgtcagttttcacataaactcattgattcgacat
ggtattcgatatcctggtttgaaatggattaagcacatggacgaagttcagcaaaaattg
acaaaagcaattattaggcctagttcccaatcaggatttatcgagaaatgggcaaacccc
tttccaaatgaaaaagaacatgcattggctccttcgggaaagtcggaactttttgaactt
ggcaagcgatttggacagcgctttaaaatgcttctcgaagtagaaactgaaaaagtacaa
tattttgtatcaagtaaagaacgtacttttgacagtagacgagcattccatgatggatta
atcagcatattttcgactgatgtaatcggcgatagttacaaagtgcccattattgatgac
aacatcctaaggtttcactctggatgcaaaaaatatctcgatcaaatagaaaacaatgac
actgctttaggagaatacttcaaattcaaaaatggaccagaaatgaacagtgttgtcaat
gatgttaagaaaaggattgttgacgatgtagatgtgattggaacaattagtggagatgat
gtacaaacaattcatcagatatgtgcctttgaattgtcattctttggcaagtcggactgg
tgtcaattttttgaaaaggaagatatggaagttatagattacttaaatgatttgaaacac
tactggcaaaaagcatatggatacaagctgagttcagacatgagctgtcctttagtaaga
catatattccagaagatggacgatgctgtgaatgactttgaagacggagaagatttcact
gtggggctgtttcgatttgcacatgcagagacattgttaccattatatgcagctttggga
ctgtataaagattctgaaccactgatggcaagcaattttgaaagacataccaacagactt
ttcaggagtagtaaaatcgtaccttttgcagcaaatattgcctttgttttgtatgaatgt
gacataaacagtgataatgaggaagaggaggatgatagtgatgatgaggatgaagaaagc
atctatgtgaagctgtatgtgaatgaggaggcaatcacaatcccagcttgtggggaggtt
ctctgtaggtacactgatgtccgagagtactattcacaattaatcgacaaatgtaacttt
ggccagatctgtgaggtggacaaaatcaaagatcatgacgaactatga

DBGET integrated database retrieval system