KEGG   Mizuhopecten yessoensis (Yesso scallop): 110457855Help
Entry
110457855         CDS       T05079                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 2-like
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi01100  Metabolic pathways
Brite
Enzymes [BR:myi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     110457855
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     110457855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Ran_BP1 YjeF_N
Motif
Other DBs
NCBI-GeneID: 110457855
NCBI-ProteinID: XP_021364973
Position
Unknown
AA seq 406 aa AA seqDB search
MYGLLTMLYTVLFVNRESERTKIVATETSDIASSESINVIIYGVFGLYTVIQIVLGNISL
TSKAVVIMTLNCTFLQILTFYLRPDLWGSLLLLGYLMVAVKWLPRRKLSPTKKAVLITGC
DRGIGFSLAKHLDSQGFHVFASFLNNQSVEQDQLVKTCSNRLHTIQMDVSNVQQVEQAAT
HVTAEVRDQGLEFWGIVNNAGICFIGNVEIMAREDMYKVMAINYFGPVNVCKAFLPLLRQ
YRGRIVNVASNAGLVPVPLMGVYCASKAALASMSEVWRFELQRWGIKVATIIPSGYKTGI
MAYDKAAMAERWWSKASDTVQRDYGRECFNIKFKQKNSEKMLSANFSEIQNNISDALLSV
FPKSYYYNGFLARSLPFLYLHLPTFIGDPIMSILTDWFDFQPNSVI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcctactgacaatgttatatactgttctatttgtgaaccgagaatcagaaaga
acaaaaatagttgccacggaaaccagtgacattgcttcaagcgagagcatcaacgttatc
atctatggcgtgtttggactatacacagtgatccagatcgttctgggaaatatcagtttg
accagtaaagctgtagtcataatgaccttgaactgcaccttcttacaaatattgaccttt
tacctacgacccgacctctgggggagcctgctactcctaggatacctcatggtggcagtg
aaatggttaccaaggaggaaactgtctccgacgaaaaaggcagttctcattactggttgt
gatcggggtattggcttcagtttggctaaacacctcgacagtcaaggtttccatgttttt
gccagtttcctcaacaaccaaagcgtggaacaagaccaacttgtaaaaacttgttccaac
cgtctacacactatacagatggatgtgagcaatgtacagcaggtggaacaagcagcaact
cacgtcacagcagaggtcagggatcaaggattggaattctggggcatcgtcaacaatgca
gggatctgttttatcggcaatgttgagataatggccagagaggatatgtacaaggtcatg
gctatcaattatttcggtcctgtgaatgtttgtaaggcatttctcccactactgcgacag
taccggggccgaattgtaaacgttgcaagtaatgcaggtttggttcccgtgcccctcatg
ggcgtgtactgtgcctccaaggctgcactggcctctatgtcggaagtgtggaggtttgag
ctacaacgctggggtatcaaggtcgccaccattatacctagtggctacaagactggcatt
atggcttacgacaaagcggccatggctgaaagatggtggtcgaaggccagcgatactgtc
cagagagactacggcagggaatgcttcaacatcaaatttaagcagaaaaattctgaaaag
atgctgagtgccaatttctctgagatccagaacaacatttccgacgcccttttatctgtg
tttcccaagtcgtactactacaacggattcctggcgcggtcgttaccattcttgtaccta
catctcccgacattcatcggcgacccaattatgtctatcctcactgattggttcgacttt
caaccaaactctgtgatataa

DBGET integrated database retrieval system