KEGG   Mizuhopecten yessoensis (Yesso scallop): 110460973Help
Entry
110460973         CDS       T05079                                 

Definition
(RefSeq) monoglyceride lipase-like isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00561  Glycerolipid metabolism
myi01100  Metabolic pathways
Module
myi_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    110460973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:myi01002]
    110460973
Enzymes [BR:myi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110460973
Peptidases [BR:myi01002]
 Serine Peptidases
  Family S33
   110460973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase DLH Lipase_3 Peptidase_S15 PGAP1 LIDHydrolase Chlorophyllase2 DUF2920 Abhydrolase_5 Abhydrolase_2 PAF-AH_p_II LIP Thioesterase Ser_hydrolase FSH1 DUF2974 LCAT
Motif
Other DBs
NCBI-GeneID: 110460973
NCBI-ProteinID: XP_021369900
Position
Unknown
AA seq 307 aa AA seqDB search
MESSANVEDDVQPKQTNGDVANEHKISNSRGQKLFCKYWNDDKETEESKDQEIRGLVLVV
HGLAEHCLFYKEVAELLINKGFYVFAHDHVGHGQSEGPRSHIDSFDQYVEDVFQHIDQVK
GKFPEKTPVFLLGHSMGGAISVLSAMAKPEYFTGVILIGPAIQPSPEAISPIKVMAGKVV
ARIFPQMCIEKLKTKDLSRDPEVVKEYEDDPLVFHNGLKAKWGLEMLKAFDVIKAGLPKV
EWPFLVLHGDQDKLCAVEGSQELYDEAKSKDKQIKVYKGFYHQIHREPREDRDIVLSDIV
DWLDKRA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcagcaaatgtggaagatgatgttcaaccaaaacaaactaatggagacgta
gccaatgaacacaaaatcagcaattctcggggacagaaactgttttgcaagtattggaat
gacgacaaagaaacagaagaatctaaagatcaggaaattaggggtttggtattagtagtg
catggccttgctgaacattgcttattttacaaggaggttgcagaacttctcataaacaag
ggcttttatgtgtttgctcatgatcatgttggtcatggccagagtgagggaccaaggtcg
cacattgatagttttgatcagtatgtggaagacgtttttcaacacatagatcaagtgaag
gggaaattccctgaaaaaacacccgtttttctccttggacactcaatgggtggagctatc
agtgtattgtctgccatggcaaaacctgagtattttactggagtaatattgataggacct
gccatccaaccaagtcccgaggcaatatcaccaatcaaggtgatggctggtaaagtggtg
gcaaggattttcccacaaatgtgtattgaaaaactgaaaacaaaggatttatcaagagat
cctgaagtggttaaagaatatgaagacgaccctctggtttttcacaatggtctgaaggca
aagtggggtcttgaaatgctgaaagcctttgacgttattaaggcaggcttgcctaaggtg
gagtggccattcctcgtgttacacggagaccaggataagttgtgtgcagtggagggctca
caggagctgtacgatgaggcaaagagcaaggacaaacaaatcaaggtctacaaaggtttc
taccaccagatacatagggaacctagagaagaccgagacattgttctgagtgacatagtc
gactggctggataagagggcttag

DBGET integrated database retrieval system