KEGG   Mizuhopecten yessoensis (Yesso scallop): 110461362Help
Entry
110461362         CDS       T05079                                 

Definition
(RefSeq) heat shock protein 70 B2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi03040  Spliceosome
myi04141  Protein processing in endoplasmic reticulum
myi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:myi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110461362
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110461362
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110461362
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myi01009]
    110461362
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:myi03041]
    110461362
   03009 Ribosome biogenesis [BR:myi03009]
    110461362
   03110 Chaperones and folding catalysts [BR:myi03110]
    110461362
   04131 Membrane trafficking [BR:myi04131]
    110461362
   03051 Proteasome [BR:myi03051]
    110461362
   03029 Mitochondrial biogenesis [BR:myi03029]
    110461362
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myi04147]
    110461362
Protein phosphatases and associated proteins [BR:myi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110461362
Spliceosome [BR:myi03041]
 Complex B
  Other components
   Prp19 complex
    110461362
 Complex C
   Prp19-CDC5 complex
    110461362
Ribosome biogenesis [BR:myi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110461362
Chaperones and folding catalysts [BR:myi03110]
 Heat shock proteins
  HSP70 / DNAK
   110461362
Membrane trafficking [BR:myi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110461362
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110461362
Proteasome [BR:myi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110461362
Mitochondrial biogenesis [BR:myi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110461362
Exosome [BR:myi04147]
 Exosomal proteins
  Proteins found in most exosomes
   110461362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A DUF1464
Motif
Other DBs
NCBI-GeneID: 110461362
NCBI-ProteinID: XP_021370483
Position
Unknown
AA seq 647 aa AA seqDB search
MASSRKGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKG
QVAMNPQNTIFDAKRLIGRKFDEQHVQSDMKHWPFRVVNNAGKPKIQVDCKGDTNKQFTP
EEISSMVLTKMKETAEAFLGHPVKDAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP
TAAALAYGLDKNLKDEKNVLIFDLGGGTFDVSILTIDEGSIFEVRSTAGDTHLGGEDFDN
RVVNHFVQEFKRKHGKDLSKNSRALRRLRTACERAKRTLSSNSEASLEIDSLFEGIDFYS
KLTRARFEDLCADLFRATLEPVEKALRDAKMDKSKIHEVVLVGGSTRIPKIQKMLEDFMN
GKQLNKSINPDEAVAYGAAVQAAVLTGDSSDVIKDVLLVDVAPLSLGIETAGGVMTKLID
RNTRIPTKTSQTFTTYSDNQPGVSIQVFEGERVMTKDNNQMGKFELNGIPPAPRGVPQIE
VQFDIDANGILNVSAEDKSTGKSNKITITNDRGRLSKEDIEKMVADAERYKDEDEKQRKR
VSARNQLENYIFSVKQAMESAGDKLSSEEKSIVCKGCEDNLKWLDSNTMADREEYEYQLN
EFQKLCSPIMTKLHRGSQQGNGGASHGGCGQEAQGGASTGPTVEEVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctcacgtaaaggaccagcgattggaatagatctcggtacaacgtattcatgt
gtcggagtattccaacatggaaaggtggaaataattgccaatgaccagggaaacaggact
acgcctagttatgtggcctttacagactcggagagattaattggggacgctgccaaggga
caagtagccatgaacccacaaaacactatttttgatgcaaaacggctcatcggacgaaaa
tttgatgaacagcatgtccagtcggacatgaaacattggccgtttagggttgtcaataac
gcaggtaaaccaaagattcaggtggactgcaaaggagacacaaataaacagttcacacca
gaggaaatcagttccatggttcttactaaaatgaaggagacggcagaagctttcttgggt
cacccggtcaaggatgctgtgatcacggtgccagcctacttcaacgactctcagagacag
gcgacaaaggacgctggtgtgattgctggacttaacgttctccgaataatcaacgaaccg
acggctgcggcgctggcatatggattggacaaaaacctcaaagacgagaaaaacgttctc
atctttgatctgggtggaggaacctttgatgtatccattttgactatcgatgaggggtcg
atattcgaggtgagatctactgctggtgacacacacttgggtggagaggatttcgacaac
agagtagtcaatcattttgtacaggagttcaaacggaaacatggcaaagacttgagtaag
aatagtagggctttgagaaggcttcgtactgcgtgtgaacgtgccaaacgaaccctttcg
agcaacagtgaggcaagtcttgaaattgattctctgtttgagggaattgacttttacagt
aagctcacgagagctagattcgaggacttgtgtgccgacttattccgtgctactctagaa
cctgtggaaaaggcacttcgtgatgcaaagatggacaaatcgaaaatccacgaggtcgtc
ttggttggcggatctacacgtataccaaaaatacaaaagatgctcgaagatttcatgaat
ggaaaacagctcaacaaatccatcaaccccgatgaagctgtagcgtacggtgccgcagtt
caggctgccgtgcttactggcgacagtagtgacgtcattaaggatgttcttctcgtggac
gtggcgcctttgtccctcggaatagaaacagctggaggtgtgatgacaaaattgatcgat
agaaacacaaggattccaacaaaaacgtcacagacatttacaacgtattctgataaccag
cctggtgttagtattcaagtgttcgagggagaacgagttatgacaaaagacaataaccaa
atgggaaagtttgaactaaacggcatccctcctgcaccccgaggtgttcctcagatcgag
gtacaatttgacattgatgctaatggaatactcaatgtgtcagccgaggacaaaagtacg
gggaaatccaacaaaatcaccatcacaaacgacaggggacgactgagcaaagaggacatt
gagaaaatggtggccgacgcggaaagatacaaagacgaagacgagaagcagagaaaaaga
gtttcggccaggaaccaactcgaaaactacattttcagtgtcaaacaagccatggaaagt
gctggtgacaaactttcgtcggaggaaaaatcaattgtctgtaagggttgtgaggataat
ctgaagtggttggacagtaatacaatggctgacagggaggaatacgaatatcaactaaat
gaatttcagaaactgtgttcacctatcatgaccaaactccacaggggttcccaacagggc
aatggtggggcatcccatggaggctgtggccaggaggcacaaggaggggcaagtacgggc
ccaactgtggaggaagtgtactaa

DBGET integrated database retrieval system