KEGG   Mizuhopecten yessoensis (Yesso scallop): 110462323
Entry
110462323         CDS       T05079                                 

Definition
(RefSeq) uncharacterized protein LOC110462323
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myi03036]
    110462323
Chromosome and associated proteins [BR:myi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    110462323
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 ArsC SDP_N
Other DBs
NCBI-GeneID: 110462323
NCBI-ProteinID: XP_021371926
Position
Unknown
AA seq 561 aa
MPDVGKSSMASPGTETDRYQRKRRPRAGGNDKKIADDEFMAAAIGDVEWLKQSLRDARGQ
INFDKNGLTSLHLAAIHGRLECLRLLIEKYKFDINLPSTTGWRAAHLCISNQTGKRALQC
LSYLLSKKADPSMPNNDGITPVHQAASEGHVQCLKELIDIGAAITGKDCRGHTPLDLAKL
WGHKKCARILAAESWHQGKDHVAKEMDYLKKLKMQQVMKEMEYEDEKRAAQEFYGEKAYQ
DWLHKQKLPPQNTGPRGRGDRTEKTTKPVGDSLQKPNSKVQRPDNTSSGKSGKSSIKRQG
TSSTTNVHVAFRTQRTPSPVERRPTTFSQYDDEFNIHERQDKKAESAKPLKARIRTPPYV
NPDVWKVPLNVPKKEYIVNLKDDFPRDQFTRMPKMKSAPMYYTGKHAPGIYVTDENSKTR
KLKMKVRDVDLPNEVVDKVLMDDPSLVERPVLFKPIHMSDVTKKKKYDVEEKGRSEISLH
ICDDFKSLLFKGSLMRANTFHCDSNSSSSSRTPESGNRNWSSARVPRERVVNAFLNLNEP
QRFPNIKGQEYDINFGEVAIM
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgccggacgttggcaagtcttccatggctagtccagggacagaaactgaccggtaccag
agaaaacgccgaccaagggctggaggcaatgacaagaaaatcgccgatgacgaatttatg
gcggctgcgataggggatgtggaatggctgaagcaaagtctacgagacgctcgggggcaa
atcaattttgacaaaaatggtctgacgtcactgcatctggcggccatccacggtcggctg
gagtgtctccgactgctaattgagaagtacaagttcgatatcaacttacccagtacgacc
ggctggagagctgcccacctgtgtataagtaatcagaccggcaagagggcgctgcagtgt
ctctcctatctcctcagcaaaaaggcagatccttccatgcccaacaatgacgggatcaca
cctgttcaccaggctgcgtctgaaggtcacgtgcagtgccttaaggagctgattgacata
ggggccgccattacggggaaggattgtagaggccacacacccctcgacctagccaaactt
tggggacacaaaaaatgtgccagaatactggccgcggaaagttggcaccaagggaaggat
cacgtggccaaggagatggattatctcaagaaattgaagatgcagcaagtaatgaaggag
atggaatacgaagatgagaaacgcgcggcccaagaattctatggggaaaaggcttatcag
gactggttacacaaacaaaaacttccgccacagaacacaggtcccagaggtcggggggac
aggacggaaaagacgacaaaaccagtcggcgattccctccaaaagcctaatagcaaggtc
caacgaccagataacacttcatccgggaaatccggaaaatcatctatcaagcgccaaggg
acgtcatcgacaaccaacgtgcacgtggctttccgcactcaaagaacaccaagtccggta
gagcgtcggccgacaaccttctcacaatatgatgacgaatttaatatacatgagagacag
gacaagaaggctgaatcggctaaaccactaaaggcaaggatacggacaccaccgtacgtg
aatccggatgtatggaaagtaccgctgaacgttcctaagaaggaatatattgtgaatcta
aaggacgatttccctcgggaccagtttacacgaatgccgaaaatgaagtcagctccaatg
tattacacgggaaagcacgcgcctggtatatacgtcacagatgaaaattctaaaacacgg
aaattaaaaatgaaggtgcgtgatgtggacctgcccaatgaagtagtggacaaagtatta
atggacgatcccagtctggtagaacggccggtcttgttcaaaccaatccacatgagtgat
gtgaccaagaagaagaaatatgacgtcgaagagaaaggacgtagtgaaattagcttgcat
atatgtgacgattttaaatctctgttattcaagggaagtctcatgagagcaaatactttt
cactgtgactcaaattcatcctcctcctctagaaccccagagtctgggaatcggaattgg
tccagcgccagggttccgcgggaaagagtcgtcaatgcttttttgaacctgaacgagccg
cagcgtttccccaatatcaaagggcaagaatacgacatcaatttcggagaagtcgcaatc
atgtga

DBGET integrated database retrieval system