KEGG   Mizuhopecten yessoensis (Yesso scallop): 110462356Help
Entry
110462356         CDS       T05079                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00510  N-Glycan biosynthesis
myi00513  Various types of N-glycan biosynthesis
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    110462356
   00513 Various types of N-glycan biosynthesis
    110462356
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:myi01003]
    110462356
Enzymes [BR:myi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     110462356
Glycosyltransferases [BR:myi01003]
 Glycan extension
  N-Glycan
   110462356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 110462356
NCBI-ProteinID: XP_021371965
Position
Unknown
AA seq 502 aa AA seqDB search
MQSFTYKKKKRANQSLLGTLGEMKVHPTRLIRTLFMVILVLFVFLNMHVLMHFEPRNGDE
INISLLRKLRHQGNWGDTAHVQTHLSELSDAKNANDSSGLEVFIPINQYNKTFLHRDIEE
SNLTQIHLEIERANREQFIHNLNKFGLKLKADSLVIVVQVHDRSQYLQILIDSLRKVNQI
KDSLLIFSHDVYSDELNKIIHSVDFCPVMQIYFPITLQLHPKEFPGQDPNDCPRDVKKEE
ALKKKCNNAAFPDKYGHYREPKYCQTKHHWLWKLDRVFDKLEVMKNYTGHVLLLEEDYYV
APDIITVIQMMNNLKKRDCKECRMLTAGNYDKTQSFVVNSGKVELATFISSRHNMGMTFA
RDLWNEIKKCAREFCDFDDYNWDWTLQHLSMKCISNKVQVMKMKATRVFHMGDCGVHHKG
KKCEPLVKQKQIEKILQDNQQHLNPNVMKVAGTSKIKIRDPKPNGGWGDIRDKRLCHSFV
SAEDERKMQRFMKSNDISILTG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcattcacgtataagaaaaaaaagcgagcaaatcagtcattgttagggacactt
ggagaaatgaaggttcacccaacccgacttatcagaaccctgttcatggtcattctcgtt
ctttttgtcttcctcaacatgcatgtgctgatgcattttgaaccgcgaaacggtgacgaa
ataaacatatcactgctccgaaagctccgtcaccaaggcaactggggagacacggcacat
gtgcaaacacacttgtccgagctcagtgatgccaaaaacgccaatgattccagcggatta
gaggtttttatacccatcaaccaatataacaaaacattccttcaccgtgatattgaggag
agcaacctgactcagattcatcttgaaattgaacgagccaatcgggaacagtttatacac
aaccttaataagtttggcctgaaactcaaggcggatagcttggttatagtggtacaagtt
catgacagatcgcaatacctccagatactgatagattctttacgaaaagtaaatcaaatc
aaagactcgctgttaatatttagtcatgatgtttattcggatgaattgaataaaatcata
cattcagtggatttttgtccggtaatgcaaatatattttcctattacacttcaattacat
cccaaagaatttcctggtcaggatcccaacgactgtccacgggacgtgaaaaaggaagaa
gctttaaagaaaaaatgcaataatgcagcatttccagacaaatacggacattacagagag
ccgaagtattgtcagaccaagcaccactggttatggaaattggaccgtgtgtttgataag
ctagaagtgatgaagaactacacgggccatgtattgctgctggaggaggattactacgtg
gctccagacatcatcactgttatacaaatgatgaataacttaaagaaaagggattgcaaa
gaatgcagaatgctgactgctgggaattatgataaaacccaaagttttgtggtgaactct
ggcaaggtggagttggcaaccttcatctcctctagacataacatgggtatgacgtttgca
agagatttgtggaatgaaattaaaaagtgtgctcgggagttctgtgactttgacgactat
aactgggactggacgctccaacatttgagtatgaagtgtatctctaacaaggtccaggtg
atgaagatgaaggccactcgcgtgttccacatgggtgactgcggtgtgcatcataaaggg
aaaaagtgtgaaccacttgttaaacaaaaacagattgaaaaaattcttcaagataatcaa
caacatctcaaccccaacgtcatgaaggttgcgggcacatccaagatcaaaatccgggac
ccgaaaccaaatggaggctggggagatatacgagataaaagactgtgtcacagctttgtg
tctgcggaagacgaacggaagatgcagcggttcatgaaatcaaatgatatatctatactt
acaggatag

DBGET integrated database retrieval system