KEGG   Mizuhopecten yessoensis (Yesso scallop): 110463860Help
Entry
110463860         CDS       T05079                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00260  Glycine, serine and threonine metabolism
myi01100  Metabolic pathways
myi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110463860
Enzymes [BR:myi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110463860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 110463860
NCBI-ProteinID: XP_021374436
Position
Unknown
AA seq 417 aa AA seqDB search
MMISSCTHMGRCIFQLTRSCTKVLRRSSKLELLRISQSSYHMAGQTELKECQGDWVVDLR
SDTLTKPTPGMRQAMANAEVGDDVFGEDPTVNELQKRCADLFGKEAALFVPTGTMGNLIA
ILTHCQGRGLEAIIGDGSHICWYEQGGIAQFAGVMPALIHNKSDGTVDLDELKSKIRPLD
DPHQPHTRLICLENTHNRCGGKVLPVSFMKEVYSIAQENNLSVHLDGARVLNAAAALKIP
VSDILQYTDSVNMCFSKGLASPVGSIIAGTKAFIATALRMRKALGGGLRQSGILAAAAIY
SLDHIVPRLGDDHIHAQMLAEGIMSVDQNVASINVDDVHTNILMITVVSERVSAEMVVNR
LTQVTAAEENELGCRVAIKGMVWGPKLIRLVTHNDISSTDLQKAVHKMQFILKEFSS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgatgataagttcatgtacacacatggggagatgcatttttcagttgaccagaagctgt
acgaaggtgttaagacgctcctccaagcttgaattattgagaattagccaatctagttac
catatggcaggccaaactgagctgaaagagtgccagggggattgggtagtggacttacgg
agtgacactctcactaaacccacccccggcatgaggcaagccatggccaatgctgaggta
ggggatgatgtctttggggaagacccaacagtaaatgaattgcaaaaaagatgtgctgat
ctgtttgggaaagaagcagctctttttgtgcccactgggacaatgggaaatcttattgct
attttgacacactgccaaggaagaggtttggaggcaatcattggtgacggtagtcatatt
tgttggtatgagcaaggaggaatagcacagtttgctggtgtgatgccagccttgatacac
aacaagtctgatggcactgtagaccttgatgaactgaagagtaaaatccgcccccttgat
gaccctcaccagccccacaccagactcatatgtctggaaaatacccacaaccgttgtggt
ggcaaggttcttcctgtcagcttcatgaaagaggtatacagcatagcccaagagaataac
ctcagtgttcacttagatggagcgagggttcttaatgcagcggcagccctgaaaatacct
gtgtcggatattttacagtacactgactctgtcaatatgtgtttctccaagggcctggct
tctccagtaggatccattatagcagggacaaaagccttcatagcgacggctctgagaatg
agaaaggccctaggtgggggcctaagacagtcagggatcctcgcggccgcagctatttat
tcactggatcacattgtcccacgccttggagatgaccacattcatgcacagatgcttgcc
gaaggaataatgtctgtggaccaaaatgttgccagtataaatgtggatgatgtgcatacc
aacattttgatgataactgttgtgtcagaaagagtgtctgcagagatggtggttaacaga
cttacacaggtaacagctgctgaggagaatgaactaggatgtcgagtggccatcaaggga
atggtttggggacccaaactaatacgcttagtcacacacaatgacatatcttcaactgac
cttcagaaagctgtccacaaaatgcagtttatcctcaaagaattttcatcttaa

DBGET integrated database retrieval system