KEGG   Mizuhopecten yessoensis (Yesso scallop): 110465208Help
Entry
110465208         CDS       T05079                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myi01009]
    110465208
Enzymes [BR:myi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     110465208
Protein phosphatases and associated proteins [BR:myi01009]
 HAD phosphatases
  Other HAD phosphatases
   110465208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 110465208
NCBI-ProteinID: XP_021376555
Position
Unknown
AA seq 90 aa AA seqDB search
MAAPVTHVIFDVDGLILDTERLYTVITDKIVEEYGKTFTWEVKSKQMGKKDVEAANILID
ELQLPITPEEYLVKARAQQSILFPTVGLLP
NT seq 271 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccccgtaacacacgtgatttttgacgtggacggactgatattagacacagaa
cgcctgtacaccgtcatcacagacaagatcgtggaggagtacggcaaaacattcacatgg
gaagtcaagtccaaacagatggggaagaaggacgtggaggcagccaacatcctcattgat
gaactgcagctaccaataacaccagaggaatatctggtaaaggccagggcccagcaaagt
attctgtttcctactgtaggtctcctcccag

DBGET integrated database retrieval system