KEGG   Mizuhopecten yessoensis (Yesso scallop): 110467158Help
Entry
110467158         CDS       T05079                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myi04131]
    110467158
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:myi04812]
    110467158
   04147 Exosome [BR:myi04147]
    110467158
Membrane trafficking [BR:myi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    110467158
Cytoskeleton proteins [BR:myi04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     110467158
Exosome [BR:myi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110467158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 FeoB_N Fez1 Ras AAA_16 ABC_tran Roc AAA_22 AAA_29 AAA_7 Exonuc_VII_L FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 110467158
NCBI-ProteinID: XP_021379792
Position
Unknown
AA seq 588 aa AA seqDB search
MASTTVTNPAPAPASTGSRGPAPPLPEKPPSVAERTRLLRSSFRKEEAEKPKVGDSRASP
VSDRSTTLPPSNSNGTTNGDKSESPSPASSVGSMTGVGRYTSDKPPPAPIQMENKEIQQP
VINAAKREAFFKGGDPSAPLPKFDPSSRFGVDRERIQEPPRKEVDHGKDKDKKYGDGTKE
LDGYVGFASLPNQVYRKSVKKGFEFTLMVVGESGLGKSTLINSLFLSDLYCAEYPGPSHR
IQKTVKVETTKTVLKENGVQLQLTVVDTPGFGDAVDNSNCWQPVIDFIDSKYDDYLNSES
RVSRITMPDYRVHTCLYFIAPTGHGLKPLDVEFMKRLHDKVNIIPLIAKADTLTPDECRE
FKKTILNEIARHKIRIYEFPECDDDEDSKIQKKLRDRVPFAVVGSNRVIEAGGKRVRGRQ
YPWGLVEVENLEHNDFIALRNMLIRTHMQDLKDVTNNVHYENYRYSKLAPSTGDSKQIKP
GSMSKDPLSQMAEEKREHDNKMKKMEAEMEQVFEMKVKEKKQKLKDSEADLQRRAEQMKK
SLEQQQKELDDRWKQFEKEKTTWEDSVGLTGKGSSENISVKKDKKRLF
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacaacggtaacaaaccccgcccctgcacctgcttccactggctcaaggggc
cccgccccacctctccccgaaaaacctccctctgtagcagaacgaacacgccttcttcga
tcaagtttccgaaaggaggaagcagaaaaaccaaaagtgggagacagtcgagcaagtccc
gtatcagaccggagcaccacactaccaccgtctaatagtaatggcaccacaaatggtgac
aaatctgaatcgccttcccctgctagcagcgtagggtccatgactggggtgggtcggtac
accagcgacaaacctccacctgcccccatacagatggaaaacaaggagatccagcaacca
gttattaatgctgccaaacgggaggccttctttaaaggtggtgacccatcagcaccactg
ccaaaatttgatccaagttctcgtttcggagtagatcgtgaacgaattcaggaacctcca
cgcaaggaagtagaccatggcaaagacaaggacaaaaaatatggggatggtacaaaggaa
ttagatggttatgttggatttgcaagtttacccaatcaagtgtataggaagtcggtcaag
aaaggatttgaattcacgctaatggttgtgggtgaatctggcttaggaaaatcaaccctg
atcaactccttgttcctgtctgacctgtactgtgcagaatatcccgggccatcccatcgg
atacagaaaacagtcaaggttgagacaacaaaaacagtactgaaggagaacggagttcag
ttacagctaactgttgtggacacaccaggttttggagacgcggtagacaatagtaactgt
tggcagccggtcattgacttcatcgatagcaaatatgatgattacctcaattctgagtcc
cgagtcagtaggatcacaatgcctgattacagagtgcacacgtgtctgtacttcatcgcc
ccgacagggcacgggttaaaaccattagatgtagaatttatgaaaagacttcatgacaaa
gtgaacatcatccctctgatcgccaaggccgacacactcacaccagacgaatgtagagag
ttcaagaagactattttaaatgaaattgcccgccataagatcaggatatatgagtttcca
gaatgtgatgatgatgaggacagtaaaatacagaagaaattaagggacagagtaccattt
gctgtggtggggagcaacagagtaatagaggctggaggaaagagagtgcggggcagacag
tacccctggggccttgtcgaggtcgaaaacttggagcacaatgatttcatagccctccga
aatatgctcatcagaacacacatgcaagacttgaaggatgttacgaataatgtccattat
gaaaattaccgatacagcaaattagcaccctctactggagacagtaaacagatcaagcca
ggctcaatgtcaaaagacccattgtcacaaatggcagaggagaagcgtgaacatgacaac
aagatgaagaagatggaggcagaaatggagcaggtatttgagatgaaagtcaaggagaaa
aaacagaagctcaaagactctgaggcagatttacaaagacgggcagaacagatgaagaag
tccttagaacaacagcagaaggaacttgatgacaggtggaagcagtttgagaaggaaaaa
accacctgggaggattctgtaggccttactggcaagggatcatcagagaatatatcagtg
aaaaaagacaaaaagaggttattctaa

DBGET integrated database retrieval system