KEGG   Mizuhopecten yessoensis (Yesso scallop): 110467438Help
Entry
110467438         CDS       T05079                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC12
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110467438
Enzymes [BR:myi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110467438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC EcsB DUF4022 Yip1
Motif
Other DBs
NCBI-GeneID: 110467438
NCBI-ProteinID: XP_021380280
Position
Unknown
AA seq 307 aa AA seqDB search
MIGRNCTRINMSCRKCSCGVGLFIRTCHTLICLAVPSTLLFKKTALQHALVEFADPLYGI
SYVCLLVFSLVMYFTACLVDPGYVPVMAHVHKKSALKHPPKDDSDEDVDPETEDHTPMLR
TATGEIDTEKLYRYCDYCEIEQPMRSKHCEDCNKCVRKYDHHCPWLETCVGERNHRFFWL
FLLSTALLILWTFVITWRGFDQEDGWEGWFHSNVLLFIDIMVLILGGFTVLGLLAFHSYL
MVKNMTTWECAAREKITYLKYLEDDYNPFDQGCFHNIYCFLCRAKSRRWEVLYEKKTEMR
KKNSSIV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcggaattgtaccagaattaacatgtcttgccggaagtgttcatgtggggtg
ggtctgtttatccgtacatgtcacacattgatttgtctggccgtgccctcaactctgctg
ttcaagaaaacagctctgcagcatgcactggtggagttcgctgacccactgtatgggata
agctacgtctgtctgctggtgttttccctcgtcatgtacttcactgcctgtctcgtagac
ccaggatatgttcctgtcatggcccatgtacataagaagtcggctctgaaacaccctcct
aaggatgatagtgatgaggatgttgacccggagacagaggaccacactcctatgttacgg
acagctactggagagattgacacagaaaaactctacagatactgtgactattgtgaaatt
gagcaaccaatgaggagcaagcactgtgaggattgtaataagtgtgtgaggaagtatgac
caccactgcccttggctggagacatgtgttggggagagaaaccaccgatttttctggctc
ttcctcctgtccacagctctcctcatactttggacctttgtcatcacctggagaggtttt
gatcaggaagacggttgggagggctggttccacagcaatgttctcctctttattgacatc
atggtactgattctcggcggattcacagtgttgggactcctcgcctttcattcgtatctt
atggtgaaaaatatgaccacttgggaatgtgccgccagggaaaaaataacctacctgaaa
tatctggaggatgactataacccgtttgatcagggctgtttccacaacatatactgtttt
ctgtgtcgggccaagagcagaaggtgggaggttctgtacgaaaagaagacagagatgcgt
aaaaagaacagtagtatagtgtga

DBGET integrated database retrieval system