KEGG   Mycetocola sp. 449: C3E77_01235Help
Entry
C3E77_01235       CDS       T05409                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
myl  Mycetocola sp. 449
Pathway
myl00072  Synthesis and degradation of ketone bodies
myl00280  Valine, leucine and isoleucine degradation
myl00650  Butanoate metabolism
myl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C3E77_01235
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    C3E77_01235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C3E77_01235
Enzymes [BR:myl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     C3E77_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AWB85395
Position
261950..262603
Genome map
AA seq 217 aa AA seqDB search
MPRTRDEMAARAAEELIDGSYVNLGIGLPTLIPNHLPDGIHVVLHSENGILGVGPYPWEG
EEDPKLINAGKETVTVLPGASYFDSAASFGMIRGGRVATAVLGAMQVSAGGDIANWAVPG
KMVKGMGGAMDLVNGAERVIVVMDHVAKDGSPKIVPECTLPLTGRACIDRIITDLAVIDV
TADGLVLRELAPGVTVGQVTESTAAPLTIDPDVKEAS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcacacgcgacgaaatggcggcaagggccgccgaagagctgatcgacggcagc
tacgtcaatctcggtatcggactgccgacgctcatccccaaccacttgcccgatggcatc
catgtcgtgctgcactccgagaacggaatactcggggtcggcccgtatccatgggagggg
gaggaggacccgaagctcattaatgcgggcaaggagacagtgacggtccttcccggcgcc
agctacttcgactcggccgcgagtttcggcatgatccgcggtggacgcgtcgcgaccgcg
gtactcggagcgatgcaggtgtccgccggcggcgacatcgcgaactgggcagtcccgggc
aagatggtgaagggaatgggcggcgcgatggacctcgtcaacggcgctgagcgggtcatc
gtggtgatggatcacgtcgcgaaggatggctcgccgaagatcgtgccggagtgcacgctt
ccgctcacgggtcgcgcctgcatcgaccgcatcatcaccgatctcgcggtcatcgacgtc
acggccgacggactcgttctccgtgaactcgcgccgggcgtgaccgtcgggcaggtgacc
gaatcgaccgcagcgccgctgacgattgacccggacgtcaaggaagcatcgtga

DBGET integrated database retrieval system