KEGG   Mycetocola sp. 449: C3E77_05820Help
Entry
C3E77_05820       CDS       T05409                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
myl  Mycetocola sp. 449
Pathway
myl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:myl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C3E77_05820
Enzymes [BR:myl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C3E77_05820
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C3E77_05820
    1.1.1.-  
     C3E77_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 ADH_N_assoc AdoHcyase_NAD Acetyltransf_6 adh_short Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AWB86175
Position
complement(1238099..1239163)
Genome map
AA seq 354 aa AA seqDB search
MKAARYYGKEDVRVEDIEEPQLRAGTVKIAPAFCGICGSDLHLFHDGPIPPAPSTDTPHP
LSHETLPVVFGHEFSGVVEEIGEGVEGLNVGDSVVVEPLMVDGTCAACKAGKYNLCAQMG
FIGISGLGGGMSEHIVVEKRWVHPVGDLPLDQAALIEPLAVGLHAAKHAGVTAGQVAVVG
GAGPIGLLLAAVLKAKGVKTIVSEVSQARREKAVSSGVADVAVDPSTEDLKAVVAAHSDG
AGADVAFDAAGIDVVVHQLLDVLAPGGRLEIVAIHTHPIEIDIAAELTFGDRVLGSSIGY
ANDHPEAIELARSGKVNLAPFITSKIVVDDLIEKGIERLVSNKDNEVKILVSMH
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcacgctactacggcaaggaagatgttcgtgtcgaggatattgaggagccc
cagctgagagcggggaccgtcaaaatcgcgccggcattctgcggcatctgcggcagcgac
ctgcacctgttccacgacggaccgatacctcccgcgccgtcgaccgacaccccgcatccc
ctgtctcacgagacgctgcctgtcgtcttcggtcatgaattttcgggtgtcgtcgaagaa
atcggcgagggcgtcgagggactcaacgtcggtgattcggtggttgttgaaccactgatg
gtcgacggcacctgtgcggcatgcaaggcgggcaagtacaacctgtgcgcgcaaatgggc
ttcatcggcatctcggggctcggcggcggcatgagcgagcacatcgtggttgagaaacgc
tgggtacaccccgtcggcgacctcccgcttgaccaggccgccctcatcgagccgctcgcg
gtcgggctgcacgccgcgaagcacgccggagtgacagcgggccaggtcgccgtcgtcggt
ggcgccggtcccatcggattgctgctggcagccgtgctcaaggccaagggcgtgaagacg
atcgtcagcgaggtctcacaggctcgccgcgagaaagctgtctcttcgggcgtcgcggat
gtcgcggtcgacccgtcgaccgaagacctcaaagccgtggtggcggcgcacagcgacggc
gccggagcggatgtcgcgttcgacgctgcgggtatcgacgttgtggtgcaccagcttctc
gacgttcttgcccctggcggccggctggagatcgtggccattcacacccacccgatcgaa
atcgacatcgccgccgagctgacgttcggtgatcgtgtgctcggcagctcgatcggttac
gcgaacgatcaccctgaggcgatcgaactcgcgcgaagcggcaaggtgaatctcgcgccg
ttcatcacctcgaagatcgtcgtcgacgacctgatcgagaaaggcatcgaacgcctcgtc
tcgaacaaggacaacgaggtcaagatcctggtgtcgatgcactag

DBGET integrated database retrieval system