KEGG   Mycetocola sp. 449: C3E77_10175Help
Entry
C3E77_10175       CDS       T05409                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
myl  Mycetocola sp. 449
Brite
KEGG Orthology (KO) [BR:myl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C3E77_10175 (mca)
Enzymes [BR:myl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     C3E77_10175 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AWB86948
Position
complement(2126308..2127174)
Genome map
AA seq 288 aa AA seqDB search
MTLRLLSVHAHPDDESSKGAATTAYYRSRGVDVLVVSCTGGERGDILNDALPDRPHAERD
IAGLRRREMAEAARILDVKHRWLGYVDSGMPNDDGSLPLNSFASVPLEISAEALVRIVRR
FKPHVMVTYDENGGYPHPDHIRSHQIAVAAFEAASDSEAYPDAGEPWQVSKLYYDQVFNY
QRLKANADTLLAEDPESPLTAQLEEMLSWRKDRPDRATTHVPAGEFFEVRDAALRAHASQ
VAPDSSFFFWSNDLQRRSWPYEDFELARSTVPTDDNESDLFAGIEDTE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgactctccggctcctgtcggtccatgcccacccggacgacgagtccagcaagggtgcc
gcgacgaccgcgtactatcgctcccgcggcgttgacgtcctcgtagtcagctgcacaggc
ggcgagcgtggagacattctcaacgatgctctcccggaccgcccgcatgccgaacgcgac
atcgccggactccgccggcgcgagatggccgaggccgcccgaatcctcgacgtcaagcat
cgctggctcggctacgtcgactcggggatgcccaacgacgacggaagcctgccgctgaat
tcgttcgcctccgtgccgctcgagatctcggccgaagccctcgtgaggatcgtgcggcgc
ttcaagccgcacgtcatggtgacctacgacgaaaacggcggttacccgcatcccgaccac
attcgcagccaccagatcgccgtcgcggcgttcgaagccgcgtctgacagcgaggcatac
cccgacgccggtgagccctggcaggtatcaaagctctactacgaccaggtcttcaactac
cagcggttgaaagccaacgcagacacgctcctcgccgaagaccccgagtcgccgctcacc
gctcagctcgaggagatgctgtcgtggcggaaggacaggccggaccgcgccacgacgcac
gttcctgctggtgagttcttcgaggtgcgggatgcggcgcttcgagcgcatgcaagccag
gtggcgccggattcgagtttcttcttctggtcgaatgacctgcagaggcgttcctggccg
tatgaagacttcgagctggcccggagcaccgtgccgaccgacgacaacgagagcgacctg
ttcgccggaatcgaggacaccgaatga

DBGET integrated database retrieval system