KEGG   Myxococcus hansupus: A176_000072Help
Entry
A176_000072       CDS       T04077                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mym  Myxococcus hansupus
Pathway
mym00790  Folate biosynthesis
mym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A176_000072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mym04147]
    A176_000072
Enzymes [BR:mym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     A176_000072
Exosome [BR:mym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A176_000072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AKQ63160
UniProt: A0A0H4WPA4
Position
complement(83859..84170)
Genome map
AA seq 103 aa AA seqDB search
MAPNLTVLAPEALQSFLSQHPEWKHEGGMIRRTYEAPSFLAGIAFVEKVAQAAEKADHHP
DIDIRWRKVTLALVTHDAGGLTARDTGLATEADRLFVEVARAQ
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaacctcaccgtgctcgctcccgaggcgctccagtccttcctgtcccagcac
cccgaatggaagcacgagggcgggatgattcgccgcacctacgaggcccccagtttcctg
gccggcatcgccttcgtggagaaagtggcgcaggcggcggagaaggcggaccaccacccg
gacatcgacatccggtggcggaaggtgacgctggcgctcgtcacgcatgacgcggggggc
ctcaccgcccgggacaccggcctggccaccgaggcggaccgcctcttcgtggaggtcgcg
cgcgcgcagtga

DBGET integrated database retrieval system