KEGG   Myxococcus hansupus: A176_001565Help
Entry
A176_001565       CDS       T04077                                 

Definition
(GenBank) LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
mym  Myxococcus hansupus
Brite
KEGG Orthology (KO) [BR:mym00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mym03009]
    A176_001565
Enzymes [BR:mym01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     A176_001565
Ribosome biogenesis [BR:mym03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A176_001565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AKQ64653
UniProt: A0A0H4WSX2
Position
complement(1821979..1822857)
Genome map
AA seq 292 aa AA seqDB search
MAGQAPAFARVGHQVVATLTETAPEVVAEAAARAVLSASGRTPWVLQVFTPDTPRGNALA
PFAESLEAAVAARLPAERRVEDAQRAREAGAVLFSLCVAPDGVTVVGAVTAREAVSLAPG
GRRRMRRAGDAPSRAAMKLEEALDGLAFEPGRGDVCADLGAAPGGWTQRLVSRGAKVVAV
DPARLMPELTGHARVKHVQESAFSYAPDEPVDWLFCDMAWRPLEVAQLLAKWGRRGWAQH
LVANIKLPMKDKNPILLRVRHTLTQEGGWEGLTVRQLYHDRDEVTVTAHKLK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtggccggacaggccccggccttcgcccgcgtgggccatcaggtggtggccacgctgacg
gagaccgcgcccgaagtcgtcgccgaggccgcggcccgggcggtgctgtccgcctccgga
cgcacgccctgggtcctacaggtcttcacgccggatacgccccgaggcaacgccctggcg
cccttcgcggagtcgctggaggccgccgtcgccgccaggctgcccgcggagcgccgggtg
gaggacgcccagcgggcacgcgaggcgggcgcggtgctcttctcgctgtgcgtggcgccg
gatggggtgacggtggtgggcgcggtgaccgcgcgcgaggccgtgtccctggccccgggc
gggcgcaggcgcatgcgcagggcgggcgacgcgccgtctcgcgcggccatgaagctggag
gaggcgctggacgggctggctttcgagccggggcgcggcgacgtctgcgcggacctgggc
gcggcgccgggcgggtggacccagcgactggtgagccggggcgccaaggtggtggcggtg
gatccagcccggctgatgccggagctgacgggccacgcccgggtgaagcacgtccaggag
agcgccttctcctacgcgcctgatgaaccggtggactggctcttctgtgacatggcgtgg
cggccgctggaggtggcacagctcctggccaagtgggggcgccgaggctgggcccaacac
ctggtggccaacatcaagctgcccatgaaggacaagaaccccattctgctgcgggtgcgc
cacacgctcacccaggagggcggctgggaggggctcaccgtccgccaactctaccatgac
cgggatgaggtcaccgtcaccgcgcacaagctgaagtga

DBGET integrated database retrieval system