KEGG   Myxococcus hansupus: A176_004991Help
Entry
A176_004991       CDS       T04077                                 

Definition
(GenBank) Selenide,water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mym  Myxococcus hansupus
Pathway
mym00450  Selenocompound metabolism
mym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A176_004991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mym03016]
    A176_004991
Enzymes [BR:mym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     A176_004991
Transfer RNA biogenesis [BR:mym03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    A176_004991
 Prokaryotic Type
    A176_004991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AKQ68079
UniProt: A0A0H4WZ62
Position
complement(6219130..6220188)
Genome map
AA seq 352 aa AA seqDB search
MAEAKAVKSKRLTEMSHCAGCAAKLRASDLAQVLGGLKSAKASQALVGFSTNDDAAVYKL
APGMAVVETVDFFPPVVDDPFQFGAIAAANALSDIYAMGARPLFALNLVCFPDELPLKVL
SKILAGGQSKADEAGIPILGGHSIRDAEPKFGMAVTGVVHPKKVLTNAGAKPGDVLFLTK
PLGSGIATTAIKRGVASKELTKRALGVMTTLNRAAGEVFASGKFKVNALTDVTGYGLLGH
LLEMMTAAKVRASLDLERIPLIADIPALAEEGVVPGGTKSNLDHVRKKVRFPEGLPECIQ
WVLADAQTNGGLLASVPARQALKALKAFEAAGVDAALIGEVQAGKPGIDVVG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcgaaggcggtgaagtcgaagcgcctcacggagatgagtcactgcgcgggg
tgcgcggccaagctgcgcgcctccgacctggcccaggtcctgggcgggttgaagtccgcc
aaggcctcccaggccctggtgggcttctccaccaatgacgacgccgccgtgtacaagctg
gcgcccggcatggcggtggtggagacggtcgacttcttcccgcccgtggtggacgacccg
ttccagttcggcgccatcgcggcggcgaacgccctgtcggacatctacgccatgggcgcg
cgtccgctcttcgcgctcaacctggtgtgcttcccggacgagctcccgctgaaggtgctg
tcgaaaatcctcgcgggcggccagtccaaggcggacgaggcgggcatccccatcctgggg
ggccacagcatccgcgacgccgagccgaagttcggcatggccgtgaccggcgtggtgcac
ccgaagaaggtgctcaccaacgcgggcgcgaagccgggcgacgtgctcttcctcaccaag
ccgctgggctcgggcatcgccaccaccgccatcaagcgcggcgtggcgtccaaggagctg
acgaagcgggccctgggcgtgatgaccacgctcaaccgcgccgccggtgaggtgttcgcc
tccgggaagttcaaggtgaacgccctcacggacgtgacggggtacggtctgctgggccac
ctgttggagatgatgaccgcggcgaaggtgcgcgcgtcgttggacctggagcgcatcccc
ctcatcgcggacatccccgcactggcggaggagggcgtcgtccccgggggcacgaagtcg
aacctcgaccacgtgcgcaagaaggtccgcttccccgaagggctgcccgagtgcatccag
tgggtgctcgcggacgcgcagaccaacggcggactgctggccagcgtccccgcgcgtcag
gcgctcaaggccctcaaggcgtttgaagccgccggggtggacgcggcgttgattggcgaa
gtccaggcgggcaagccgggcatcgacgtggtgggctga

DBGET integrated database retrieval system