KEGG   Myxococcus hansupus: A176_005718Help
Entry
A176_005718       CDS       T04077                                 

Definition
(GenBank) glutamyl-Q-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mym  Myxococcus hansupus
Pathway
mym00860  Porphyrin and chlorophyll metabolism
mym00970  Aminoacyl-tRNA biosynthesis
mym01100  Metabolic pathways
mym01110  Biosynthesis of secondary metabolites
mym01120  Microbial metabolism in diverse environments
Module
mym_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
mym_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A176_005718
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A176_005718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mym01007]
    A176_005718
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mym03016]
    A176_005718
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mym02048]
    A176_005718
Enzymes [BR:mym01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     A176_005718
Amino acid related enzymes [BR:mym01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A176_005718
Transfer RNA biogenesis [BR:mym03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A176_005718
 Prokaryotic Type
   Other AARSs
    A176_005718
Prokaryotic defense system [BR:mym02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    A176_005718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AKQ68806
UniProt: A0A0H4WZD8
Position
7110210..7111112
Genome map
AA seq 300 aa AA seqDB search
MHLGNIRSALLGWLQARAVGGRFLLRIEDLDRARCKPQYVEDLLRDLAWLGLDWDETALF
QSQRDDVYRDAQARLEREDLVYPCFCTRAEIARAASAPHGLSDEGPRYPGTCARLTREQI
SERARTRAPAYRFRARPGEVRFEDGLQGPYAQDVDVVVGDFVVRRNDGVASYQLAVVVDD
AATDITHVLRGDDLLSSTPRQLQLYAALGLRAPDFLHVPLVLGEDGKRLAKREGAFALAE
LRERGVPPERVLGLLASWSGLGDGAPVTLAELVRDFRPEALPREPVTTSETALQTALGLC
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgggcaacatccgcagcgcgctgctcggctggcttcaggcgcgcgcggtggga
ggccgcttcctgctgcgcatcgaggacctggaccgtgcgcgctgcaagccccagtacgtg
gaggacctgctgcgcgacctcgcgtggctggggctcgactgggacgagacggcgctgttc
cagagccagcgcgatgacgtctaccgcgacgcgcaggcccggctggagcgcgaggacctc
gtgtatccgtgcttctgcacccgcgcggagattgcacgggccgccagcgcgccgcatggg
ctctccgacgaaggacctcgttaccccggcacctgcgcgcgcctcacccgggagcagatc
tccgagcgcgctcgcacccgcgccccggcgtaccgctttcgcgcgcgccccggtgaggtg
cgattcgaggatggactgcaaggtccctacgcgcaggacgtggacgtggtggtgggtgac
ttcgtggtgcgccgcaacgacggcgtggccagctatcagctcgcggtggtggtggatgac
gcggcgacggacatcacccacgtccttcgcggcgatgacctgctgtcctccacgccccgg
cagctccagctctacgcggcgctggggctgcgcgcgccggacttcctgcacgtgccgctg
gtgctgggtgaagacggcaagcggctcgccaagcgcgaaggggccttcgcgctcgcggag
cttcgcgagcgtggtgtgcctcccgagcgcgtgctgggcctgctcgcgtcctggagcggg
ctcggcgacggagcgcccgtgacgctggccgaactggtgcgtgactttcgccccgaagcg
ctgccccgtgaacccgtcaccaccagcgagaccgcgctccagacggcactcggcctgtgc
tga

DBGET integrated database retrieval system