KEGG   Myxococcus hansupus: A176_007567Help
Entry
A176_007567       CDS       T04077                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mym  Myxococcus hansupus
Pathway
mym00071  Fatty acid degradation
mym00072  Synthesis and degradation of ketone bodies
mym00280  Valine, leucine and isoleucine degradation
mym00310  Lysine degradation
mym00362  Benzoate degradation
mym00380  Tryptophan metabolism
mym00620  Pyruvate metabolism
mym00630  Glyoxylate and dicarboxylate metabolism
mym00640  Propanoate metabolism
mym00650  Butanoate metabolism
mym00900  Terpenoid backbone biosynthesis
mym01100  Metabolic pathways
mym01110  Biosynthesis of secondary metabolites
mym01120  Microbial metabolism in diverse environments
mym01130  Biosynthesis of antibiotics
mym01200  Carbon metabolism
mym01212  Fatty acid metabolism
mym02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A176_007567
   00630 Glyoxylate and dicarboxylate metabolism
    A176_007567
   00640 Propanoate metabolism
    A176_007567
   00650 Butanoate metabolism
    A176_007567
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A176_007567
   00072 Synthesis and degradation of ketone bodies
    A176_007567
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A176_007567
   00310 Lysine degradation
    A176_007567
   00380 Tryptophan metabolism
    A176_007567
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A176_007567
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A176_007567
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A176_007567
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mym04147]
    A176_007567
Enzymes [BR:mym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A176_007567
Exosome [BR:mym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A176_007567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKQ70655
UniProt: A0A0H4XAG2
Position
9285318..9286529
Genome map
AA seq 403 aa AA seqDB search
MSQEAFIFDAVRTPRGKGRKGSLHGIKPISLLVGLVDALKKRHPNLDPKRIDDIVLGVVS
PVGDQGADIARTLVLAAGLPETVGGVQLNRFCASGLTAVNMAAQQVRSGWEHLVIAGGVE
SMSRVPMGSDGGAWAMDPVTNFDTYFVPQGISADLIATIEGFTREDVDRYAERSQVLAGK
AWAGGYFKNSIVPVVDQNGLTVLEHDELMRPDSTVASLGKLNPAFAVMGEAGGFDAVALQ
KYHHVERIEHVHTPGNSSGIVDGAALVLIGSEQVGKSLGLTPRARIAAVATSGADPTIML
TGPTPATQKLLQIAGLSVKDIDLFELNEAFASVVLKYQKDLGIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRKARRAVITLCVGGGMGVATLIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaagcattcatcttcgacgccgttcggacccctcgcggcaagggccggaag
ggctcgttgcatggcatcaagcccatctccctgctggtggggctggtggacgcgctcaag
aagcgccacccgaacctggacccgaagcgcatcgacgacatcgtgctcggcgtcgtctcg
cccgtgggcgaccagggcgcggacatcgcgcgcacgctggtgctggcggcggggctgccg
gagacggtgggcggcgtgcagctcaaccgcttctgcgcctccggcctgacggcggtgaac
atggccgcgcagcaggtgcgctcgggctgggagcaccttgtcatcgcgggcggcgtggag
agcatgtcgcgcgtgcccatgggctcggacggtggcgcgtgggccatggaccccgtcacc
aacttcgacacgtacttcgtgccgcagggcatctccgcggacctcatcgccaccatcgag
ggcttcacccgcgaggacgtggaccgctacgcggagcgctcgcaggtgctcgcgggcaag
gcgtgggcgggcgggtacttcaagaactccatcgtccccgtggtggaccagaacgggctc
accgtgctggagcatgacgagctgatgcgcccggactccaccgtggcgtcgctgggcaag
ctcaacccggccttcgccgtgatgggtgaggcgggcggcttcgacgcggtggcgctgcag
aagtatcaccacgtggagcgcatcgagcacgtgcacacgccgggcaactcgtcgggcatc
gtggacggcgcggcgctggtgctcatcggttcggagcaggtgggtaagtcgctgggcctc
acgccgcgcgcgcgcatcgccgcggtggccacgtccggcgcggacccgaccatcatgctc
accggtccgacgccggccacgcagaagctgcttcaaatcgcgggcctgtcggtgaaggac
atcgacctgttcgagctgaacgaggccttcgcctcggtggtgctcaagtaccagaaggac
ctcggcattccggacgagaagctcaatgtgaacggcggcgccatcgccatggggcacccg
ctgggcgccacgggcgcgatgattctggggaccatggtggacgagctggagcgccgcaag
gcgcgccgcgcggtcatcaccctgtgcgtgggcggtggcatgggcgtggccaccctcatc
gagcgcgtctga

DBGET integrated database retrieval system