KEGG   Mycobacterium sp. NRRL B-3805: MyAD_01040Help
Entry
MyAD_01040        CDS       T05013                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MyAD_01040
Enzymes [BR:myn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MyAD_01040
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MyAD_01040
    1.1.1.-  
     MyAD_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMO04009
Position
complement(220964..222004)
Genome map
AA seq 346 aa AA seqDB search
MKAAVYYGPNKVDVTDVPEPEPGPGTVKVQVGYNGICGTDLHEYYAGPIFVPTEPHPLTG
AQLPIVMGHEFSGTITALGEGVTGWAEGDRVAIEPIYRCGRCGPCLAGTYNICAQIGFHG
LMSDGGMAEYTVVPTDMLHKLPDNVSLELGALVEPMSVAYHAATLGDPDPDRTAMVFGAG
PIGIGLWFALRGKGIEDVFVVEPSATRRSAIEALGARTLDPTALDVPGFIADHTDGHGAG
AVYDAAGVAPAVETALACVGARKAMVSVAIYEKPLTTPLLNLVMNESRIQGSLCYTAADF
QAVIGLMAEGAYDTTGWVTAIGLDDVIDEGFEALHAGTKMKVLVQP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtgtattacggacccaacaaagtggatgtcaccgacgtccccgaaccg
gagcccgggccgggaacggtgaaggtgcaggtcggctacaacggcatctgcggcaccgac
ctgcacgagtactacgcgggccccatcttcgtgccgaccgaaccgcatccgttgaccggt
gcgcaactgcccatcgtgatgggccacgagttctccgggaccatcaccgcgctcggcgag
ggggtcaccgggtgggccgagggcgaccgggtcgccatcgagccgatctaccgctgcgga
cggtgcggaccatgtctggccggcacctacaacatctgcgcacagatcggatttcacggt
ctgatgtccgacggtgggatggccgagtacacggtggtgccgaccgacatgctgcacaag
ctgcccgacaatgtctcgctcgaactcggcgccctggtcgaaccgatgtcggtggcctat
cacgccgccaccctcggcgatcccgaccccgaccgcaccgccatggtgttcggtgccgga
ccgatcggtatcggcctctggttcgcgctgcgcggcaaaggcatcgaggatgtgttcgtc
gtcgaaccctcggcgacgagacggtcggccatcgaggcgctcggtgcccgcacgctggat
ccgacggcactggacgtcccgggcttcatcgccgatcacaccgacgggcatggcgcgggc
gcggtatacgacgccgccggtgtcgcaccggcggtcgagaccgccctggcatgcgtcggg
gcgcgcaaggcgatggtcagcgtcgcgatctacgagaagccgctgaccaccccgctgctg
aacctggtgatgaacgaatcccggatccagggctcattgtgttacaccgcagccgatttc
caggccgtcatcggtctgatggccgagggcgcctacgacaccaccggctgggtgaccgcc
atcggcctcgacgatgtcatcgacgagggcttcgaggccctgcatgccggaaccaagatg
aaagtactggtgcaaccatga

DBGET integrated database retrieval system