KEGG   Mycobacterium sp. NRRL B-3805: MyAD_05595Help
Entry
MyAD_05595        CDS       T05013                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
myn  Mycobacterium sp. NRRL B-3805
Brite
KEGG Orthology (KO) [BR:myn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MyAD_05595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 OPA3
Motif
Other DBs
NCBI-ProteinID: AMO04748
Position
1178136..1179380
Genome map
AA seq 414 aa AA seqDB search
MSAELIILVLLIATALAFDFTNGFHDTGNAMATSIATGALKPKTAVLLAGVLNLIGAFLS
VEVAVTVTTSVLKVQDSKSGQLLPGIDASTGLTIIFAGLIGGILWNLLTWLFGIPSSSSH
ALFGGLIGAGLAALGLAGVNWSGVTQKVLIPAVAAPAIACLVAGCGTWLVYRLTRNVAEK
RRKDGFRWGQIATASLVALSHGTNDAQKTMGVIALALITTGHLTGDVKEQGLPFWIIFSC
AVAIGLGTYLGGWRVIRTLGKGLVEIESPQGFAAEASSAAIILSSSAAGMALSTTHVATG
SILGSGVGKPGAEVRWAVAGRMAVAWLITLPAAGLVGALSYWLSHGVKTLTGSALVGDGL
IFAILVALSGYMWWRAQQQKVDHSNVNADWDDSTNSVIPADLRDDAVAKPTASV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagagctgatcatcctggtgctactgattgccacggcacttgcattcgacttc
accaacggctttcacgacaccggcaatgcgatggccacctcgatcgccacgggcgcgctc
aagccgaagaccgcggttctgcttgccggtgtgctgaacctgatcggcgcgttcctctcg
gtcgaggtggcggtcaccgtcacgacctcggtgctcaaggtccaggacagcaagtccggc
cagttgctccccggtatcgatgcctcgacgggtttgacgatcatcttcgccggcctgatc
ggcggcatcctgtggaacctgctcacctggttgttcggcatcccctccagctcgtcgcat
gcgctcttcggcggactgatcggtgcgggccttgccgcgctcgggctggccggggtcaac
tggtccggcgtcacccagaaggtgctcatcccggcagttgccgcccccgcgatcgcctgc
ctggtcgccggctgcggcacctggctggtctaccgactgacccgcaacgtcgccgagaag
cggcgcaaggacggtttccgctgggggcagatcgccaccgcctcattggtcgcgctctcg
cacggcaccaacgacgcgcagaagacgatgggtgtcatcgcgctggcgctcatcaccacc
ggccacctgaccggtgacgtgaaggaacagggtctgccgttctggatcatcttcagctgc
gcggtggccatcggcctcggtacctacctgggcggctggcgggtcatccggacactcggc
aagggcctcgtcgagatcgagtccccgcagggttttgccgccgaggcctcctcggccgcc
atcatcttgagctcgagcgctgcgggtatggcgctgtcgaccacccacgtcgccaccggc
tccatcctgggcagcggtgtcggcaagccgggtgcggaggtgcgttgggcggtggccggc
cggatggcggtggcctggctgatcacgctgcccgccgcaggcctggtcggcgcgttgtcc
tactggttgtcccacggggtcaagacgctgaccggttcggcattggtgggcgacggtctc
atcttcgccatcctggtcgcgctctcgggctacatgtggtggcgcgcgcagcagcagaag
gtcgaccacagcaacgtcaacgccgattgggacgactcgaccaactcggtcatcccggcc
gatctgcgcgacgacgccgtcgccaagcccaccgcatcggtctga

DBGET integrated database retrieval system