KEGG   Mycobacterium sp. NRRL B-3805: MyAD_11175Help
Entry
MyAD_11175        CDS       T05013                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00020  Citrate cycle (TCA cycle)
myn00620  Pyruvate metabolism
myn01100  Metabolic pathways
myn01110  Biosynthesis of secondary metabolites
myn01120  Microbial metabolism in diverse environments
myn01130  Biosynthesis of antibiotics
myn01200  Carbon metabolism
Module
myn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MyAD_11175
   00620 Pyruvate metabolism
    MyAD_11175
Enzymes [BR:myn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MyAD_11175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMO08267
Position
2393075..2394568
Genome map
AA seq 497 aa AA seqDB search
MSDSKTVKTDVVLVGAGIMSATLSALLRLLEPNWSITLVERLDGAAAESSDPWNNAGTGH
SALCELNYTPQNSDGTVDIAKAVNVNEQFQVSRQFWTYAVENGVLPDVRNFLNPIPHVSF
VEGADNVAYLRARYEALVSNPLFSAMEYIDDTDEFTRRLPFMAAKRTFAEPVALNWTQSG
TDVDFGSLSRQLIGYTASQGMTTLFGHDVRDLSKDSDGGWTVKVINRRTRAKHKIKAKFV
FVGAGGGALPLLQKAGIPEAKGFGGFPVGGQWLRSANPDLTAGHQAKVYGAPPLGAPPMS
VPHLDTRVINGKSYLLFGPFAGWSPKFLKQGKVTDLPLSVKPNNLASMVGVGLTEMSLLK
YLIGQLLLSEADRVDALREFAPNAVDSDWELDIAGQRVQVIRRKGAGGVLEFGTTVLTAA
DGSIAGLLGASPGASTAVPAMLEVMERCFADRYPTWLPKLKEMVPSLGTKLSGEPALFRE
IWDHGTKVLKLDAPAPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgactcgaagaccgtgaagacggacgtggtactcgtcggtgccggcatcatgagc
gccaccctgagtgctctgctgcgcctgctcgaaccgaactggtcgatcaccttggtcgag
cgcctcgacggtgcggccgccgagagcagtgacccgtggaacaacgcgggcaccggccac
tcggcgctctgtgagctgaactacacgccgcagaattccgacggtaccgtcgacatcgcc
aaggcggtcaacgtcaacgagcagttccaggtctcgcgccagttctggacctacgccgtc
gagaacggcgtgctgcccgacgtgcgcaacttcttgaacccgatcccacacgtcagcttc
gtcgagggcgccgacaacgtcgcctacctgcgcgcccggtacgaggcgttggtgtccaac
ccgctgttctcggccatggagtacatcgacgacaccgacgagttcacccgtcggctgccc
ttcatggccgccaagcggacgttcgccgagccggtcgccctgaactggacgcaatccggc
accgatgtcgatttcggctcgctgtcgcgccagctgatcggttacaccgcaagccagggc
atgaccacgctcttcggccacgacgtgcgcgatctgtccaaggattccgacggcggttgg
acggtcaaggtgatcaatcggcgcacccgggccaagcacaagatcaaggcgaagttcgtg
ttcgtcggcgcgggcggcggtgcgcttccgctgctgcagaaggcgggcatccccgaggcc
aagggattcggcggcttccccgtcggcggtcagtggctgcggtcggccaatcccgatctc
acggccggacaccaggccaaggtctacggcgcgccgccgctgggcgccccgccgatgtcg
gtgccccacctggacacccgggtgatcaacggcaagtcctacctgctgttcgggccgttc
gccgggtggtcgccgaagtttctcaagcagggcaaggtcaccgacctgccactctcggtg
aaacccaacaacctcgcctcgatggtgggtgtcggactcaccgagatgagcctgctgaag
tacctgatcggccagctgttgctcagcgaggccgatcgggtcgacgcgctgcgtgaattc
gcacccaacgcagtcgattcggattgggagctggacatcgccggtcagcgtgtgcaggtg
atccggcgcaagggtgccggtggtgtgctggaattcggcaccaccgtgctcaccgccgcc
gacggcagcatcgccggtctgctcggtgcgtcccccggcgcgtcgaccgcggtgccggcc
atgctcgaggtgatggagcgctgcttcgccgaccgatacccgacctggctgcccaagctc
aaggagatggtgccctcgctggggaccaagctctccggtgagcccgcactgttccgcgag
atctgggatcacggcaccaaggtgctcaaactcgatgcaccagcgcccgtatga

DBGET integrated database retrieval system