KEGG   Mycobacterium sp. NRRL B-3805: MyAD_23805Help
Entry
MyAD_23805        CDS       T05013                                 

Definition
(GenBank) 4-hydroxy-2-oxopentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00360  Phenylalanine metabolism
myn00362  Benzoate degradation
myn00621  Dioxin degradation
myn00622  Xylene degradation
myn01100  Metabolic pathways
myn01120  Microbial metabolism in diverse environments
myn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MyAD_23805
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MyAD_23805
   00622 Xylene degradation
    MyAD_23805
   00621 Dioxin degradation
    MyAD_23805
Enzymes [BR:myn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     MyAD_23805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm ZnuA
Motif
Other DBs
NCBI-ProteinID: AMO07684
Position
complement(5098248..5099294)
Genome map
AA seq 348 aa AA seqDB search
MSEIFFNPVWDVRMTDTSLRDGSHHKRHQFSADEVASIVAALDTAGVPVIEVTHGDGLGG
SSFNYGFSKTPEQELIKLAAETAKDAKIAFLMLPGVGTKEDIIQAQNNGGEICRIATHCT
EADVSIQHFGLARELGLETVGFLMMSHTISPEKLAAQARIMADAGCQCVYVVDSAGALVL
DQVADRVSALVAELGDDAQVGFHGHENLGLGVANSIEAVRAGAKQIDGSCRRFGAGAGNA
PVEAMIGVFDKIGVKTGIDFFEIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFLKH
AIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEIKREQEAQNA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagattttcttcaatccggtgtgggatgtccggatgaccgatacgtcgctgcgc
gacgggtcccatcacaagcgtcaccagttcagcgccgatgaggtggcctcgatcgtcgct
gcccttgataccgcgggcgtgccggtgatcgaggtgactcacggtgatgggctgggtggg
tcgagcttcaattacgggttttcgaaaactcctgagcaggagttgatcaagctggcggcc
gagacggccaaggacgccaagatcgcgtttttgatgttgccgggtgtggggaccaaggag
gacatcatccaggcgcagaacaacggtggggagatctgccgcatcgcgacccattgcacc
gaggctgatgtgtcgattcagcatttcgggttggcccgtgaactcggcctggagacggtg
ggttttttgatgatgagccacaccatcagcccggagaagctggctgcccaggcccggatc
atggccgatgcgggatgtcagtgtgtgtatgtggtggattcggcgggtgcgttggtgctc
gatcaggtcgctgatcgggtgtctgcgttggtggccgagctcggtgatgacgcgcaggtc
ggttttcatggtcatgagaatctcgggttgggggtggccaacagcatcgaggcggtgcgc
gcgggtgccaagcagatcgatgggtcgtgtcggcggttcggtgctggtgcgggtaatgcg
ccggtggaggcgatgatcggggtgttcgacaagatcggggtgaagaccgggatcgatttc
ttcgagatcgccgatgccgccgaagaggttgtggccccggcgatgcccgcggaatgcctg
ctggatcgcaacgcgttgatcatgggttactcgggggtgtattccagtttcctcaagcac
gccatccgtcagtccgagcgctacggcgtacccgcgcaccaactgctgcaccgggccggg
caacgcaaactcatcggcggccaagaagaccaactcatcgacatcgccctggaaatcaaa
cgcgaacaggaagcccagaacgcctga

DBGET integrated database retrieval system