KEGG   Mycobacterium sp. NRRL B-3805: MyAD_25100Help
Entry
MyAD_25100        CDS       T05013                                 

Definition
(GenBank) amidohydrolase
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00340  Histidine metabolism
myn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MyAD_25100
Enzymes [BR:myn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     MyAD_25100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AMO07891
Position
complement(5374206..5374895)
Genome map
AA seq 229 aa AA seqDB search
MCRHLGWLGEPVSVASVVFDPPSGLLVQSYAPRRQKHGTVNADGWGVGFFDEGPRRWRSD
KPLWGDASFASVAPTLRSGCIVAAVRSATVGMPIESSASAPFTDGSWLLSHNGVVDRAVL
PVTRDAESTVDSAVLAAHIFDRGLGSLGETIAEIGARDPGARLNILAGDGSRLLATTWGD
TLFALDRADGVVLASEPYDDDPAWLDIPDRHLVEVAATGLKLTPLKGSR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagacatctgggctggctcggagagccggtgtcggtggcatcggtggtattcgat
ccgcccagcggactattggtgcagtcctatgcgccacggcggcagaagcacggcaccgtc
aatgccgacggatggggtgtcgggttcttcgacgagggcccgcggcggtggcgcagtgac
aaaccgctgtggggggacgcgtcgttcgcatcggtggccccgacgttgcgcagcggatgc
atcgtggcggcggtgcgttcggccacggtgggcatgccgatcgaatcatcggcctcggca
ccgttcaccgacggcagctggctgctgtcgcacaacggagtcgtcgaccgcgcggtgctc
ccggtcacccgggacgcggaatcgaccgtcgacagtgcggtcttggcggcgcacatcttc
gaccgcggcctcgggtcactcggggagaccatcgccgagatcggtgcccgcgatcccggc
gcgcggctgaacatcctggccggtgacggttcccggttactcgccacgacgtggggcgac
accctgttcgcactggaccgggccgatggcgtggtgttggccagcgaaccctacgacgac
gacccggcctggctcgacatccccgaccggcacctcgtcgaggtggcggcgacaggcctg
aagctcacccctctgaaaggatctcgatga

DBGET integrated database retrieval system