KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_03100Help
Entry
OEM_03100         CDS       T02732                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00020  Citrate cycle (TCA cycle)
myo00620  Pyruvate metabolism
myo01100  Metabolic pathways
myo01120  Microbial metabolism in diverse environments
myo01200  Carbon metabolism
myo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OEM_03100
   00620 Pyruvate metabolism
    OEM_03100
Enzymes [BR:myo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     OEM_03100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 RnfC_N ATP-grasp_3 GCV_H AstE_AspA DUF2118 Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AGP61846
UniProt: S4Z395
Position
complement(311892..315275)
Genome map
AA seq 1127 aa AA seqDB search
MLTKVLVANRGEIAIRAFRAAYELEMATVAVYPYEDRNSVHRLKADESYQIGEEGHPVRA
YLSVDDIVATAQACGADAIYPGYGFLSENPDLAAACAAAGITFVGPSAEVLELTGNKARA
IAAARASGLPVLASSAPSTSVDELVTAAESMTFPLFVKAVAGGGGRGMRRVTDPAALPEA
IEAASREAESAFGDASVFLEQAVINPRHIEVQILADNHGNVMHLYERDCSVQRRHQKVIE
IAPAPNLDPQLRMSICADAVAFAQSIGYTCAGTVEFLLDERGNHVFIEMNPRIQVEHTVT
EEITDVDLVSAQLRIASGQTLEDIGLHQDSIVPHGAALQCRITTEDPANGFRPDTGRITA
YRTPGGAGIRLDGGTTLGAEISAHFDSMLIKLSCRGRDFPTAVRRARRAVAEFRIRGVST
NIPFLQAVLDDPDFQAGRITTSFIEERPQLLTARSSADRGTKILSYLADVTVNKPHGERP
STVYPHDKLPDIDLSTDPPPGSKQRLTELGPQRFAAWLRESRGVAVTDTTFRDAHQSLLA
TRVRTSGLIKVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLAALREAMPNICL
QMLLRGRNTVGYTPYPETVTTAFVEEATATGIDIFRIFDALNNVDSMRPAIDAVCDTGAA
VAEVAMSYTGDLSDPAEKLYTLDYYLKLAEQIVEAGAHVLAIKDMAGLLRAPAAATLVSA
LKSRFDLPVHVHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAN
TDYDTGLSLPAVCDLEPYWEALRKVYAPFESGLPSPTGRVYHHEIPGGQLSNLRQQAIAL
GLGDRFEDIENAYAGADAILGHLVKVTPSSKVVGDLALALVGAGVSAQDFAEDPARYDIP
DSVIGFLRGELGDPPGGWPEPLRTKALDGRGPAKPEQPLTADDEKALATPGAQRQAALNR
LLFPGPAKELEDHREAYGDTSGLSANQFFYGLRQGDEHRVELERGVELLIGLEAISDPDE
RGMRTVMCILNGQLRPVVVRDRSIATDVPAAEKADRANPDHVAAPFAGVVTVTAEVGEEV
EAGQTIATIEAMKMEAAVTAPKAGKVARIAVSRTAQVEGGDLLVVID
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgttgacaaaagtcctggtcgccaatcgcggcgagatcgcgatccgcgccttccgcgcc
gcctacgaactggaaatggccaccgtggcggtctacccctacgaggaccgcaattcggtg
caccggctcaaggccgacgagtcgtaccagatcggcgaggagggccacccggtccgcgcc
tacctgtcggtcgacgacatcgtcgccacggcgcaggcgtgcggggcggacgccatctac
ccgggctacgggttcctgtccgagaacccggacctggcggcggcgtgcgcggcggcgggc
atcacgttcgtcggcccgagcgccgaggtgctcgagctcaccggcaacaaggcgcgcgcg
atcgcggcggcgcgggcgtcgggcctgccggtgctggcgtcctcggcgccctcgacatcg
gtggacgagctggtgacggccgccgagtcgatgacgtttccgctgttcgtcaaggcggtc
gccggtggtggcggccgcgggatgcgtcgggtcaccgaccccgcggcgctgccggaggcg
atcgaggcggccagccgggaggccgaatccgccttcggggatgcctcggtgtttctcgaa
caggcggtgatcaacccgcgccacatcgaggtccagatcctggcggacaaccacggcaac
gtgatgcacctctacgaacgggactgcagcgtgcagcggcggcaccagaaggtgatcgag
atcgccccggcgccgaacctggatccacaactgcggatgagtatttgcgccgacgcggtg
gcgttcgcgcaaagcatcggctacacctgcgcgggcacggtcgagttcttgctcgacgag
cgcggcaatcacgtgttcatcgagatgaatccccgcatccaggtggagcacacggtgacc
gaggagatcaccgacgtcgacctggtgtccgcccagctgcgcatcgcgtccggtcaaacg
ctggaagatattggcctgcaccaggattcgatcgtcccgcacggcgcggcgctgcaatgc
cgcatcaccaccgaagacccggcgaacggtttccgcccggacaccggccgcatcaccgcc
taccgcaccccgggcggcgcgggaatacgactggacggcggcaccaccctgggcgcggag
atcagcgcgcatttcgactcgatgctgatcaagctcagttgccggggccgcgacttcccc
accgcggtgcgccgcgcccggcgggcggtcgcggagttccgcatccgcggtgtgtcgacg
aatatccccttcctgcaagcggtcctggacgaccccgacttccaggccgggcgcatcacc
acgtcgttcatcgaggaacgcccgcagctgctcaccgcgcgcagctcggccgaccgcggc
accaagatcctcagctacctggccgacgtcaccgtcaacaagccccacggtgagcgcccg
tcgacggtgtacccgcacgacaagctgcccgacatcgacctgtcgaccgacccacccccg
ggctccaagcagcgtctgaccgagctcggaccccagcgattcgcggcctggctccgcgag
tcgcgcggcgtcgccgtcacggacaccacgttccgcgacgcgcaccagtcgctgctggcg
acccgcgtccgcaccagcggcctgatcaaggtcgcgccctacctcgcgcggaccatgccg
caactgttgtcggtggagtgctggggcggcgcgacttacgatgtggcgctgcggttcttg
aaagaggacccgtgggagcgcctggcggcgctgcgggaggcgatgcccaacatctgcctg
cagatgctgctgcgcgggcgcaacaccgtcggctacacgccctatccggagacggtgacg
acggcgttcgtcgaggaggcgacggccaccggcatcgacatcttccggatcttcgacgcg
ttgaacaacgtcgactcgatgcgcccggccatcgacgcggtgtgcgacaccggggcggcg
gtggccgaggtggcgatgtcctacaccggggatctcagcgatccggccgaaaagctttac
acgctcgactattacctcaagttggccgaacagatcgtcgaagcgggcgcgcacgtcctg
gcgatcaaggacatggccgggttgttacgcgcgccggccgccgcgacgctggtctcggcg
ctcaaatcccggttcgacctgccggtgcacgtgcatacccacgacaccccgggcggacaa
ctcgcgagttacgtggcggcctggcacgcgggggccgacgccgtcgacggtgccgctgcc
ccgctcgcggggaccaccagccagcccgcgctgtcatcgatcgtggccgccgccgccaac
accgactacgacaccgggttgtcgctgccggcggtgtgcgacctggaaccgtactgggag
gcgctgcgaaaggtgtacgcgccgttcgaatccgggctgccgtccccgacgggccgcgtc
taccaccacgagatccccggtggccaactgtcgaacctgcgccagcaggccatcgcgctg
ggtctcggcgaccggttcgaggacatcgaaaacgcctacgccggcgccgacgccatcctc
gggcacctcgtcaaggtcacgccgtcgagcaaggtggtcggcgacctggcgctggcgctg
gtcggggcgggcgtcagcgcgcaagacttcgccgaagatcccgcgcgctatgacatcccg
gattcggtcatcgggttcctgcgcggcgaactcggcgatccgcccggcggctggccggag
ccgttgcgtaccaaggcgttagacggccgcggcccggccaagcccgagcagccgctgacg
gccgacgatgaaaaggcgttggccacaccgggcgcccaacggcaggcggcgctgaaccgg
ctgctgttccccgggccggccaaagagctcgaggaccaccgcgaggcctacggcgacacc
tccggattgagcgccaaccagttcttctacgggctgcgccagggggacgagcatcgcgtg
gagctggagcgcggtgtggagctgctgatcgggttggaggccatctccgaccccgacgaa
cgcggcatgcgcaccgtgatgtgcatcctcaacggtcagctgcggcccgtcgtggtgcgc
gaccgcagcatcgccaccgacgtcccggccgccgagaaggccgaccgcgccaatcccgat
cacgtcgccgccccctttgccggcgtcgtcacggtcaccgccgaggtcggcgaggaggtc
gaggccggccagacgatcgcgacgatcgaggccatgaagatggaggccgccgtcaccgcc
cccaaggccggcaaggtcgcgcgaatcgcggtgtcgcgcaccgcacaagtcgagggcggc
gacctcctggtggtgatcgactag

DBGET integrated database retrieval system