KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_09340Help
Entry
OEM_09340         CDS       T02732                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:myo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    OEM_09340
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     OEM_09340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Shikimate_DH 3HCDH_N Sacchrp_dh_NADP ADH_zinc_N 2-Hacid_dh_C NmrA
Motif
Other DBs
NCBI-ProteinID: AGP62470
UniProt: S4Z6K6
Position
complement(910629..911420)
Genome map
AA seq 263 aa AA seqDB search
MILDRFRLDDKVAVITGAGRGLGAAIALAFAEAGADVLIASRTESRLEAVAEQVRAAGRR
AHVVAADLAHPESTAELAGQAVEAFGKLDIVVNNVGGSMPNTLLTTSTKDLKDAFTFNVG
TAHALTLAAVPLMLEHSGGGSIINITSTMGRLAGRGFAAYGTAKAALSHYTRLTALDLCP
RIRVNAIAPGSILTSALDVVASNDELRSPMEKATPMRRLGDPVDIAAAAVYLASPAGNFL
TGKTLEVDGGLTFPNLDIPVPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatccttgacaggttccgtctcgacgacaaagtcgccgtcatcaccggtgcaggccgt
ggcctcggggcggccatcgcgctggcgttcgccgaggcaggcgccgacgtcctcatcgcc
tcgcgaactgaatcccgactagaggccgtcgccgaacaggtccgcgccgccgggcgccgc
gcccacgtcgtggccgccgacctggcgcatccggaatccaccgccgagctggccggccag
gccgtcgaggcattcgggaaactagacatcgtcgtcaacaacgtcgggggatccatgccc
aacacgttgttgacgacctcgacgaaggatctcaaagacgccttcaccttcaacgtcggc
accgcccacgcgctcacactggctgcggtgccgttgatgctcgagcactccggcggcggc
agcatcatcaacatcacctcgaccatgggccggctggccggacgtggcttcgcggcctac
ggcaccgccaaggccgcgctgtcccattacacccggctgaccgccctggacctgtgccca
cggattcgggtcaacgcgatcgcgccgggatcgatcctcacctccgcgctggacgtggtt
gcctccaacgacgagctgcggtcgccgatggagaaggccaccccgatgcgccggctgggc
gatccggtcgacattgccgctgcggcagtctatttggcgtctcccgccggcaacttcctg
accggcaagaccctcgaggtcgacggcggcctcaccttccccaatctcgacatccccgtc
ccggacctgtga

DBGET integrated database retrieval system