KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_21200Help
Entry
OEM_21200         CDS       T02732                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00071  Fatty acid degradation
myo00072  Synthesis and degradation of ketone bodies
myo00280  Valine, leucine and isoleucine degradation
myo00310  Lysine degradation
myo00362  Benzoate degradation
myo00380  Tryptophan metabolism
myo00620  Pyruvate metabolism
myo00630  Glyoxylate and dicarboxylate metabolism
myo00640  Propanoate metabolism
myo00650  Butanoate metabolism
myo00900  Terpenoid backbone biosynthesis
myo01100  Metabolic pathways
myo01110  Biosynthesis of secondary metabolites
myo01120  Microbial metabolism in diverse environments
myo01130  Biosynthesis of antibiotics
myo01200  Carbon metabolism
myo01212  Fatty acid metabolism
myo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OEM_21200
   00630 Glyoxylate and dicarboxylate metabolism
    OEM_21200
   00640 Propanoate metabolism
    OEM_21200
   00650 Butanoate metabolism
    OEM_21200
  Lipid metabolism
   00071 Fatty acid degradation
    OEM_21200
   00072 Synthesis and degradation of ketone bodies
    OEM_21200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OEM_21200
   00310 Lysine degradation
    OEM_21200
   00380 Tryptophan metabolism
    OEM_21200
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OEM_21200
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OEM_21200
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OEM_21200
Enzymes [BR:myo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OEM_21200
Exosome [BR:myo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OEM_21200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGP63655
UniProt: S4ZAL9
Position
complement(2202518..2203987)
Genome map
AA seq 489 aa AA seqDB search
MVVGVGEVTHRGNDVVDPIDLAVEAARRAVNDTGRAVERRIDTVAAPGILVISRDNPASR
IAEAMRISPARRISCPVGGNTPQYLVEVLGGEIAEGRADVVLVVGAESGHSARKLQGETL
LNCPAPPRSGDESLGDARPGLSQAEMSVGLSWPHEVYPIFESAIAARHGHDFDAQREWLG
TLMAPFTAEAARHPEQAWFPRTRSAAELSEVTAENRMVCLPYPKLLNSNMSVDMAAAFIV
VAAEMADELGVSRDRWVFPWSAATCNDVYFPVQRPDLSRSTGIEVAARKALDAGGLTTDD
IRWFDLYSCFPSAVQIATEALELDPRDDRGLTVTGGLPYHGGPGNNYVSHAIVEMVRRCR
RDPTDAGLVTGLGWYSTKHSVGVWSATPPPTGWRLIDTAEEQAQIDSSRLAVAGVDEATG
RATVDGYTVVYDRDGRPRWTPIIAHLSDGRRVVARSDDPQIAEAMAGEMYVGRTVCLRNT
GSSTGFELP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtcggcgtaggcgaagtcacccatcgcgggaacgacgtcgtggacccgatcgac
ttggcagtggaggccgcacgccgcgcggtcaacgacaccggtcgcgcggtcgaacggcgc
atcgacacggtcgcggctcccggcatcctggtcatatcgcgggacaatcccgccagcagg
atcgccgaagcgatgcgcatcagtcccgcccgccgcatcagctgtccagtcggcggaaac
accccgcagtatctcgtcgaggtgttgggtggagaaatagccgagggccgcgcagatgtt
gtcctggtcgtcggcgcggagagcgggcattccgcgcgcaagctccagggtgagacactt
ctcaactgcccagccccgccccgctccggcgacgaatcccttggggacgcccgccccggg
ctgagtcaagccgagatgtcggtaggtctgagttggccgcacgaggtgtatcccatcttc
gagtccgcgatcgccgcacgccacggccatgatttcgatgcgcaaagggagtggctggga
acgctgatggcaccgttcacagccgaggcggcgcgccatcccgagcaggcctggttcccg
cgcacacgaagtgccgccgaactcagcgaagtaacggcggaaaaccgcatggtgtgcttg
ccttatcccaagctgctcaacagcaacatgtccgtcgacatggctgccgcgttcatcgtt
gtggcggccgagatggcagacgaattgggcgtctcgcgcgatcgttgggtctttccctgg
tcagcggcaacctgcaacgacgtgtacttccccgtgcaacggccggacctcagtcgctca
acgggtatcgaagtagcggcacggaaggctctcgacgcgggcggattgaccaccgacgac
attcggtggttcgacctctactcctgcttcccgtcggcagttcagatagccaccgaggct
ctcgagttggacccccgcgacgatagaggcctcacagtaaccggaggcctcccctatcac
ggcggtcccggtaacaactacgtcagtcacgcgatcgttgagatggtccgacgctgcaga
cgcgaccccaccgatgccggactcgtcaccggcctcggttggtattcgacgaaacattcg
gtcggtgtgtggtcggccacccctccaccaaccgggtggcgactgatcgacacggcagag
gaacaagctcagatcgattcatcgcggctggccgtcgcaggcgtcgacgaggcgaccggt
cgcgcgacagtggacgggtacacggtcgtgtacgaccgagacggacgacctcgatggaca
ccgatcatcgcgcacctctccgacgggcgaagagtcgtcgcacgcagcgacgatccgcag
attgccgaggcgatggcgggcgagatgtacgttggcagaacggtttgcctccgaaacaca
gggtcgtccacgggattcgagcttccatga

DBGET integrated database retrieval system