KEGG   Myroides sp. A21: MYRA21_0324Help
Entry
MYRA21_0324       CDS       T03521                                 

Gene name
plcN
Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
myr  Myroides sp. A21
Pathway
myr00562  Inositol phosphate metabolism
myr00564  Glycerophospholipid metabolism
myr00565  Ether lipid metabolism
myr01100  Metabolic pathways
myr01110  Biosynthesis of secondary metabolites
myr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:myr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MYRA21_0324 (plcN)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYRA21_0324 (plcN)
   00565 Ether lipid metabolism
    MYRA21_0324 (plcN)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MYRA21_0324 (plcN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:myr02042]
    MYRA21_0324 (plcN)
Enzymes [BR:myr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     MYRA21_0324 (plcN)
Bacterial toxins [BR:myr02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   MYRA21_0324 (plcN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 ERp29
Motif
Other DBs
NCBI-ProteinID: AJA67551
Position
complement(335214..337679)
Genome map
AA seq 821 aa AA seqDB search
MSTTRRDFIKKSALFSSGLFFAEAMPASIQRAFDIKAPEGSTFLDAEHIVFLMQENRSFD
HCFGTLKGVRGFNDPRAMKLKDGLPVWFQSDIHKNIYGPFRLDIENTKVTWMGGLPHSWK
DMVEARNEGKMDNWLIAKRPGNAEYKDLPLTMGYFSRADIPFYYALADAFTVCDQHFCSS
LTGTSANRSYFWAGAIREKPRDPNSIAHVDNGQINYKDVSWTTYPERLEKANVSWKVYQN
ELSVPVGFDWHAESWLANFTDNNLEFYKQYNVRFHKAHYDYMVLELERLKGSLNDKTLAK
DKIQEVEGKIQQLEKDIDLYSPSKFEALSEFDKAIHKKAFTTNTSDPDYHKLEEMTYMER
GVEKTMEVPKGDIFYQFRKDVDENKLPMVSWLVAPCNFSDHPSAPWFGAWYLSEAIDILT
KNPEVWKKTIFVLTYDENDGYFDHIAPFVPPLTTDKTMGKVAKGMDTQDEWVTKEQERVR
TDKLDSQLASPIGLGYRVPMIIASPWTRGGWVNSEVLDLTSTIQFLEYFIEKKTGKQVIE
ENISSWRREVCGNMTSVFQSERDLREVNLDFVDRKDYIARIMNAKEKKVPGDFNAFTKKE
VLGAKHWTLLSKFPKQEEGIKKACALPYNLNANVKLAGSKTQLQMDFTVESNQLKNKVYA
APVQVYDMLGASPSRGIWDFAVRDNEPMDYYWKVEDGEQYHYNIHGPNGFFRSFKGSKKN
LDIYVEVLLLTDLSISVKLKNNGADTVNVALDNSLYLKKATIIELPPNKEELLKWDYTSS
NGWYDLMISCKEDIEWKQYYAGHIENGQASITDPFMASLSK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaacaagaagagattttataaagaagtccgctttattttcaagcggactcttt
ttcgcagaggctatgccagcatctattcagagagcatttgatatcaaagctcctgaagga
tctacgttcttagatgcagaacatattgttttcttaatgcaagagaatagatcttttgac
cattgtttcgggactttaaaaggagtaaggggatttaatgatcctagagctatgaagctt
aaggatggtctgcctgtctggtttcagtcagatattcataaaaatatttatggtcctttt
agacttgatattgagaatactaaggtgacttggatgggtggcttaccacatagttggaag
gatatggtagaggctcgtaacgagggtaaaatggataattggttgatagccaaacgacct
ggtaatgccgagtataaggatttacctctgacgatgggatatttctcacgagctgatatt
cctttctattacgcattagcagatgcctttacagtatgtgatcagcacttttgttcttct
ctgacaggtactagtgctaatcgatcttatttttgggctggtgctatccgcgagaagcca
agagatcctaactctatagctcatgtggataatgggcagataaactataaagatgtcagc
tggactacttacccagaacgattagaaaaagcgaatgtgtcgtggaaagtatatcagaat
gagttaagtgttcctgtgggatttgattggcatgcagagagttggttagcgaattttaca
gataataatttagagttctataagcaatataatgtgcgttttcacaaggctcattatgac
tatatggtactagagttggagagattaaagggaagcttgaatgacaagactctcgctaaa
gataaaatacaagaagtagaaggtaagatacagcagctagaaaaagatattgatctatac
tctccttctaaatttgaagcattaagcgaattcgataaagctattcacaagaaggcattt
actactaatacaagtgatccagattatcacaagctagaggagatgacctatatggagaga
ggcgtggagaaaacaatggaggtgcctaagggggatatcttttatcagtttagaaaagat
gtagatgaaaataagttgcctatggtaagctggttagttgcgccgtgtaacttttcggat
catccttcagcgccttggtttggggcgtggtatttatcagaagcgatagatatcctaacg
aagaacccagaggtgtggaagaagacaatatttgtgttgacatacgatgaaaatgatggt
tactttgatcatattgctccttttgtaccaccgttaacgactgataagacgatgggtaaa
gtggctaaaggaatggatacgcaagatgagtgggtcactaaagaacaagaaagagtaaga
acagataaacttgatagtcaattagctagtccgataggattagggtatagagtacctatg
attatagcctcgccttggactagaggaggctgggtaaactcagaggtgttagacttgacc
tctactatacagttcttagaatactttatcgaaaaaaagacaggtaaacaagttatcgaa
gagaatatatctagctggagaagagaggtgtgtggtaatatgacgagtgtattccaatct
gaacgcgatctaagagaggtaaacttagacttcgtagatcggaaggactatatcgctaga
atcatgaatgcaaaagagaagaaggtacctggagactttaatgcgtttacaaaaaaagag
gtattaggggctaaacattggacactgttatccaaatttcctaaacaagaagaaggaata
aagaaggcatgtgctttaccttataatctgaatgcaaatgtgaaactggcaggaagtaaa
acgcagttacaaatggatttcacggttgagtctaatcagttaaagaataaggtgtatgca
gctcctgtacaagtatatgatatgttaggagctagcccgtcaagaggcatttgggacttt
gcggttagagataatgaaccaatggattattactggaaggtagaagatggagagcagtat
cactataatatacatggacctaatgggttctttagaagctttaagggaagtaagaaaaat
ttagatatttatgttgaggttcttttactcacagatttaagtatctctgtgaaattaaaa
aataatggcgcggatactgtaaatgttgctttagataatagtttgtatctaaaaaaagca
acgattatagagttgcctcctaataaagaagaattacttaaatgggattatacaagctca
aacggctggtatgatttgatgataagttgtaaagaggatatagagtggaagcaatattat
gctggtcatattgagaatggtcaagcaagtataacggatccatttatggcaagtctgtct
aaataa

DBGET integrated database retrieval system