KEGG   Myroides sp. A21: MYRA21_1600Help
Entry
MYRA21_1600       CDS       T03521                                 

Definition
(GenBank) Uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
myr  Myroides sp. A21
Brite
KEGG Orthology (KO) [BR:myr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MYRA21_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Trehalose_PPase Rad21_Rec8
Motif
Other DBs
NCBI-ProteinID: AJA68753
Position
1700522..1700917
Genome map
AA seq 131 aa AA seqDB search
MEKMISQTTKGIKISVNTEYEGSFFKSKKICYAFSYKITIENNSTDYIQVKGRLWEIYDA
LNSVQIVKGEGVVGEQPIIEPGTKYTYSSGCVLNSSMGAMQGFYEVLNLANQTYFNVEIP
NFKLVAPFVLN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatgatttcacaaacgacgaagggaataaaaatatctgtaaatacggaatac
gaaggcagtttttttaaatcaaaaaagatatgctatgctttttcatataaaataacaatt
gaaaataattctactgattatattcaggtgaaagggcgactatgggagatctatgatgct
ctgaatagtgtacagatagtaaaaggagaaggtgtagtaggtgaacaacctattatagag
cctggtaccaaatatacatatagtagtggatgtgtcttaaattcatctatgggagctatg
cagggattctatgaggtacttaatctagcgaaccaaacttattttaatgtagaaatccca
aactttaagctagtagcccctttcgtattgaattag

DBGET integrated database retrieval system