KEGG   Myroides sp. A21: MYRA21_3489Help
Entry
MYRA21_3489       CDS       T03521                                 

Gene name
nfnB
Definition
(GenBank) Nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
myr  Myroides sp. A21
Pathway
myr00633  Nitrotoluene degradation
myr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:myr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MYRA21_3489 (nfnB)
Enzymes [BR:myr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     MYRA21_3489 (nfnB)
  1.-  
   1.-.-  
    1.-.-.-  
     MYRA21_3489 (nfnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AJA70580
Position
3817286..3817888
Genome map
AA seq 200 aa AA seqDB search
MSFLEIAKSRYTTKKYDSTKKISGDKIEQLKDILQLSPSSINSQPWKFTIVESTEVKNLL
ASNSAFNQTKIEDASHLIVFNVLSTKEYFEKLRLENAAEGSKMYYNNFLKPKSEEEITAW
LKNQVYISLGFFLAACGTMGIDATPMEGINTLEFDKIINEDGVYKSVFAVAIGYRNSEDT
NQPSVTPKNRLDKETTIEVR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagctttttagaaattgctaaaagtagatacacgactaaaaaatatgattctactaaa
aaaataagtggtgacaaaatagaacaattaaaagatatactacaactaagtccttcatcg
attaatagccaaccatggaaatttactattgttgaaagcacagaagtaaaaaatctatta
gcaagtaactcagcttttaatcaaacaaagatagaagatgctagtcacttaattgtgttc
aatgtactaagtacaaaagaatactttgagaaattgcgtttagaaaatgcagctgaaggt
tctaaaatgtattacaataattttctaaaacctaaatcggaagaagagattacagcttgg
ttaaaaaatcaagtatatatttcattaggattcttcttagcagcttgtggtacaatggga
attgatgcaacaccaatggagggtattaataccctagagtttgataagattatcaatgaa
gatggagtttacaaaagtgtttttgctgtagcaataggatacagaaattctgaagatact
aaccaaccatctgtaactcctaaaaatcgcctagataaagaaactacaatagaagttaga
taa

DBGET integrated database retrieval system