KEGG   Mycobacteroides abscessus DJO-44274: NF92_20125Help
Entry
NF92_20125        CDS       T03534                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mys  Mycobacteroides abscessus DJO-44274
Pathway
mys00071  Fatty acid degradation
mys00072  Synthesis and degradation of ketone bodies
mys00280  Valine, leucine and isoleucine degradation
mys00310  Lysine degradation
mys00362  Benzoate degradation
mys00380  Tryptophan metabolism
mys00620  Pyruvate metabolism
mys00630  Glyoxylate and dicarboxylate metabolism
mys00640  Propanoate metabolism
mys00650  Butanoate metabolism
mys00900  Terpenoid backbone biosynthesis
mys01100  Metabolic pathways
mys01110  Biosynthesis of secondary metabolites
mys01120  Microbial metabolism in diverse environments
mys01130  Biosynthesis of antibiotics
mys01200  Carbon metabolism
mys01212  Fatty acid metabolism
mys02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NF92_20125
   00630 Glyoxylate and dicarboxylate metabolism
    NF92_20125
   00640 Propanoate metabolism
    NF92_20125
   00650 Butanoate metabolism
    NF92_20125
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NF92_20125
   00072 Synthesis and degradation of ketone bodies
    NF92_20125
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NF92_20125
   00310 Lysine degradation
    NF92_20125
   00380 Tryptophan metabolism
    NF92_20125
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NF92_20125
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NF92_20125
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NF92_20125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mys04147]
    NF92_20125
Enzymes [BR:mys01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NF92_20125
Exosome [BR:mys04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NF92_20125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIV17625
Position
complement(4103682..4104830)
Genome map
AA seq 382 aa AA seqDB search
MSEAYIIDAVRTAVGKRNGALSKVHPLDLGAATFKGLFDRVDVDPDAIDDVYMGVLDAIG
GQAGNAGRLAWLAGGYPEEVPGATVDRQCGSSQQAISFAAQAVMSGTADLIVAGGFQNMS
QIPISAAMLVGKEYGFTSPTAESEGWLHRYGDQEISQFRGAEMIAEKWDISREEMERFAL
SSHEKAFAAIRNGHFDNEIIPVGDFRVDEGPRESTLEKLASLNPLVEGGRLTAALASQIS
DGGSATLVASEQAVKAHGLTPRARVHHISARGDDPVFMLTGPIPATRYALEKTGLTMDEI
DVVEINEAFAPVVLAWAKELDVDLKKVNPNGGAMALGHPLGATGAKLFATMLNELERTGG
RYGLQTMCEGGGTANVTIIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggcgtacatcattgacgctgtgcgtaccgctgtcggtaagcgcaacggcgcg
ctgtccaaggtgcacccgctggatctgggtgcggccaccttcaagggtttgttcgaccgc
gtcgacgtcgatcccgacgccatcgacgacgtgtacatgggtgtgcttgatgccatcggt
gggcaggccggaaatgccggacgtctggcctggctcgcgggcggatacccggaagaggtg
ccgggtgccaccgtcgaccggcagtgtggctcgagtcagcaggccatctcctttgccgcc
caagctgttatgtccggcaccgcggacctgatcgtggcggggggttttcagaacatgagc
cagattccgatctcggccgccatgctcgtcggcaaggaatatggattcacctcgcccacg
gccgagtccgagggctggctgcaccgctacggcgatcaggagatctcccagttccgcggc
gccgaaatgatcgccgagaagtgggacatcagccgtgaggagatggagcgcttcgcgctc
tccagccatgagaaggccttcgccgcaatccgcaacgggcacttcgacaacgagatcatc
ccggtcggcgacttccgcgtcgacgaggggccgcgcgaatccaccctggagaagctggcc
agcctgaatcccctggtcgagggcggccgactcaccgcggcgttggcttcgcagatttcc
gatggcggcagcgccacgctggtcgcctcggagcaggccgtcaaggcgcacgggctcacg
ccgagggcgcgcgtccaccacatcagtgcccggggtgacgacccggtgttcatgctgacc
gggccgatccccgccacccggtacgcgctggagaagaccggtctgaccatggatgagatc
gacgtcgtggagatcaacgaggcatttgcccccgtcgtgctggcctgggccaaggagctc
gacgtcgacctgaagaaggtcaacccgaacggcggggcgatggctttggggcacccgctg
ggtgccaccggggccaagctgttcgccaccatgctcaacgagttggagcgcaccggcggc
cgctatggcctgcagacgatgtgcgaaggcggtggcacggccaacgtcaccatcatcgaa
cgcctctga

DBGET integrated database retrieval system