KEGG   Mycobacterium sp. VKM Ac-1817D: G155_01320Help
Entry
G155_01320        CDS       T03634                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00633  Nitrotoluene degradation
myv00983  Drug metabolism - other enzymes
myv01100  Metabolic pathways
myv01110  Biosynthesis of secondary metabolites
myv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    G155_01320
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    G155_01320
   00983 Drug metabolism - other enzymes
    G155_01320
Enzymes [BR:myv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     G155_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AIY44449
UniProt: A0A0A1FL82
Position
282701..283540
Genome map
AA seq 279 aa AA seqDB search
MGLDLTAYLDRIGVAGPVSADLDTLRNVVAAHGRSIPFENLDPLLGIPVADLSAEALADK
LITRRRGGYCYEHNGLLGYALDELGYGVDRLAGRVVWMKEPDAPLPALTHNVLAVTVPGV
AGRFLVDVGFGGQTLSSPIRMQTGAVQQTRHEPYRLTEVPTLGAPVYELAAQVRGQWQPL
YRFTAVPQPRIDLEVGSWYVSTHPGGIFVVGLTAALVTDDARMNLRGRNLAIHRHDGTEK
IRFDTATQVLEALTARFGINLSDLDGVDVEARVAQVLDS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggactggacctgactgcgtacctcgaccggatcggcgttgcgggtccggtgtcggcc
gatctggacaccctgcgcaacgtcgtcgccgcgcacggtcgttcgatcccgttcgagaac
ctcgacccactgttgggtataccggtcgctgacctcagtgcagaggcattggcggacaag
ctgatcacccggcgccgcggtggttactgctacgagcacaacggcttgctcggctacgcc
ctggatgaactgggatacggcgtcgaccggttggccgggcgggtggtctggatgaaggaa
cccgatgcgccgttgcccgcgctcacgcacaacgtgctggccgtgacggtccccggagtg
gccgggcgcttcctggtcgacgtcggtttcggcgggcagacgttgtcatccccgatccgg
atgcagaccggtgcggtgcagcagacccgccacgagccctaccggctgacggaggtgccc
acgttgggcgcgccggtatacgaactggccgcgcaggtccgggggcagtggcagccgctg
taccgatttaccgcggttccgcaaccgcgcatcgaccttgaggtcggaagctggtatgtg
tcaacgcatcccggtggcatcttcgtcgtcgggctgaccgcggccctggtcaccgacgac
gccaggatgaacctgcgcggccgcaacctcgccatccatcgccacgacggcacggagaag
atccgcttcgacaccgccacgcaggtgctcgaagcgctgaccgcgcggttcgggatcaac
ctgtccgatctcgacggcgtcgacgtcgaggcccgggtggcgcaggtgctggacagctga

DBGET integrated database retrieval system