KEGG   Mycobacterium sp. VKM Ac-1817D: G155_01955Help
Entry
G155_01955        CDS       T03634                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00071  Fatty acid degradation
myv00072  Synthesis and degradation of ketone bodies
myv00280  Valine, leucine and isoleucine degradation
myv00310  Lysine degradation
myv00362  Benzoate degradation
myv00380  Tryptophan metabolism
myv00620  Pyruvate metabolism
myv00630  Glyoxylate and dicarboxylate metabolism
myv00640  Propanoate metabolism
myv00650  Butanoate metabolism
myv00900  Terpenoid backbone biosynthesis
myv01100  Metabolic pathways
myv01110  Biosynthesis of secondary metabolites
myv01120  Microbial metabolism in diverse environments
myv01130  Biosynthesis of antibiotics
myv01200  Carbon metabolism
myv01212  Fatty acid metabolism
myv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G155_01955
   00630 Glyoxylate and dicarboxylate metabolism
    G155_01955
   00640 Propanoate metabolism
    G155_01955
   00650 Butanoate metabolism
    G155_01955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    G155_01955
   00072 Synthesis and degradation of ketone bodies
    G155_01955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    G155_01955
   00310 Lysine degradation
    G155_01955
   00380 Tryptophan metabolism
    G155_01955
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G155_01955
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G155_01955
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G155_01955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myv04147]
    G155_01955
Enzymes [BR:myv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     G155_01955
Exosome [BR:myv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G155_01955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIY44553
UniProt: A0A0A1FII1
Position
complement(429816..431003)
Genome map
AA seq 395 aa AA seqDB search
MSYRAAVVGVGLTDATSPRKQNFSVLELCQQSVWTALEHSGVRPESLDAVVTGNIDGFEG
TVLAGKSQTRLLGVGEHLPLTIINTGGTTGGNLMQVAARMVRAGTHRRVLVLGGPTFFGA
SDLQAAINTNSPMIIEQPLGMGAYHMGAFAASAYQARFGMSADDLATVVVADHTKAQRNP
HAHLRYPVSKEDVANGRPLSSPLTQPMVCPVSTSAVAMVVADADSDEDFAATPALIKAMG
ISSDPYLGGGKGDFSQMQNLAILARKVYALADIRNPRSDFDVVEIFAPYAHMQPLALEAL
GFADPGDAIELIRSGATDLGGDLPVNMSGGPKCTNAGVAGELAPYAYAALQVMGDAPEPI
QVHGARRSLAHGTGGTFFQFENLAVFETYRRSTTS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcgcgccgcagtcgtcggtgttggcctgaccgacgcgacatcaccacgcaaa
cagaacttttcagtactggaactctgccaacagtcggtatggaccgctctggagcacagt
ggtgtgcgaccggaaagcctcgatgcggtggtcaccggcaacatcgacggtttcgagggg
acggtgttggcgggcaagagccaaacgcggttgctcggcgtcggtgagcacctacccctg
acaatcatcaacaccgggggcaccaccggcggaaacctgatgcaggttgccgcgcggatg
gtgcgcgccggcacgcaccggcgtgtccttgtcctgggcgggccgaccttcttcggagcc
tcggacctgcaggcagcgatcaacaccaactcgccgatgatcatcgaacaacccctgggc
atgggcgcttatcacatgggcgcctttgccgccagcgcctatcaggcacggtttgggatg
tctgccgacgacttggcaaccgtggtggtggccgaccacacgaaagcgcaacgcaatccg
cacgcacacctgcgctacccggtatccaaagaggacgtggccaacggccgcccgctgtcc
tcaccgttgacccagccgatggtctgcccggtgtcgacgtcggcggtggccatggtggtg
gccgacgccgacagcgacgaggatttcgcggccacgccggcgctgatcaaagccatggga
atatccagcgatccgtatctcggtggcggcaaaggcgacttttcccagatgcagaatctg
gccatcctcgccagaaaggtctatgcgctggccgacatccgcaatcctcggagcgatttc
gacgttgtggaaatcttcgcgccgtatgcgcatatgcagcccttggccttggaagcgctc
gggttcgccgaccccggcgacgccatcgaattgatccggtcgggagcgaccgacctgggc
ggagacctaccggtcaacatgtccggcggccccaagtgcaccaacgccggcgtcgcaggc
gaattggctccctacgcctacgccgcactgcaggtgatgggcgacgcacccgaaccgatc
caggtccacggcgcccgccggtccctggcccacggcaccggcggaaccttcttccaattc
gagaacctggccgtgttcgaaacctaccgaaggagcaccacctcatga

DBGET integrated database retrieval system