KEGG   Mycobacterium sp. VKM Ac-1817D: G155_08610Help
Entry
G155_08610        CDS       T03634                                 

Definition
(GenBank) homoserine acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00270  Cysteine and methionine metabolism
myv00920  Sulfur metabolism
myv01100  Metabolic pathways
myv01110  Biosynthesis of secondary metabolites
myv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    G155_08610
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    G155_08610
Enzymes [BR:myv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     G155_08610
    2.3.1.46  homoserine O-succinyltransferase
     G155_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AIY45614
UniProt: A0A0A1FPM9
Position
complement(1813301..1814431)
Genome map
AA seq 376 aa AA seqDB search
MTITEEPAVSTVPLPAEGEISVVHIGALKLENGTVLPDVSIAVQRWGELSPARDNVVMVL
HALTGDSHVTGPAGDGHPTAGWWDGVAGPGAPIDTDQWCAISTNVLGGCQGSTGPGSLAP
DGKPWGSRFPQITIRDQVEADRAALAAFGITEVAAVVGGSMGGARALEWLVGHPDEVRAG
LVLAVGARATADQIGTQSTQVAAIKADPDWQGGDYYGTGRAPLAGMEIARRFAHLTYRGE
EELDDRFGNDAQGDEDPTAGGRYGVQSYLEYQGGKLARRFDPGTYVALSDALSTHDVGRD
RGGVAEALRGCPVPVIVGGITSDRLYPIRLQQELAELLPGCNGLDVVDSAYGHDGFLVET
EVVGKLIRRTLELAQR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaccgaagaaccggccgtgtccaccgtgcccttgcctgccgaaggcgagatc
agcgtggtgcacatcggcgccctgaaactggagaacggcactgtcctgcctgacgtgtcg
atcgcagtgcagcgctggggcgagctgtcccccgcgcgcgacaacgtggtgatggtgctg
cacgcgctgaccggcgactctcatgtcaccggacccgcgggcgacggtcatccgaccgcc
ggttggtgggacggggtggccggacccggcgccccgatcgacaccgaccagtggtgcgcg
atctcgaccaacgtcctcggcggctgccaggggtccaccggaccgggatcacttgctccg
gacggaaagccttggggctcaaggtttccccagatcacgatccgggaccaggtcgaggcc
gatcgggctgcgctggccgcgttcggtatcaccgaggtggctgctgtggtcggcggctcg
atgggtggggcccgggcgctcgaatggctcgtcgggcaccccgacgaggtccgggccgga
ctggtgctggccgtcggggcacgcgccaccgccgatcagatcggtacccagagcacccag
gtggccgcgatcaaggccgatccggactggcagggcggtgactactacggcaccggccgc
gcgccgctggcaggcatggagatcgcccggcgcttcgcacacctgacctatcgcggtgaa
gaggaactcgacgaccgcttcggcaacgacgcgcagggcgacgaggacccgaccgcaggc
ggacgctacggcgtgcagagctacctcgaataccagggcggcaagctggcccgtcgattc
gacccgggcacgtatgtggcgctttcggacgccctgtccacccacgatgtgggccgggac
cgtggcggggtggccgaggcgctgcgcggttgtccggtgcccgtcatcgtcggcggaatc
acctccgaccggctctatccgatccggttgcagcaggaactggccgagttgttgcccggc
tgcaacggcctggacgtcgtcgactcggcctacggccacgacggctttctggtcgagacg
gaagtggtgggcaagttgatccgccgcacactggagttggcacagcggtga

DBGET integrated database retrieval system