KEGG   Mycobacterium sp. VKM Ac-1817D: G155_11225Help
Entry
G155_11225        CDS       T03634                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00500  Starch and sucrose metabolism
myv01100  Metabolic pathways
Module
myv_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    G155_11225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:myv01003]
    G155_11225
Enzymes [BR:myv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     G155_11225
Glycosyltransferases [BR:myv01003]
 Polysaccharide
  Storage polysaccharide
   G155_11225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glycogen_syn KR NmrA
Motif
Other DBs
NCBI-ProteinID: AIY46049
UniProt: A0A0A1FQY4
Position
complement(2334939..2336180)
Genome map
AA seq 413 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLATALAEAGHEIVVLSRRPTDTDPSTHPSTDEVSEG
VRVVAAAQDPHEFEFGTDMMAWTLAMGHSMVRTGLAVKDNSGDRWVPDLVHAHDWLVAHP
AIALAEYFDVPLVSTIHATEAGRHSGWVSGPISRQVHAVESWLVRESDSLITCSASMSDE
ITQLFGPELSEIRVIRNGIDADLWPFAPRRPRQGPPELLYLGRLEYEKGVHDAIAALPRI
RRAHPGTTLTIAGDGTQQQWLVEQARKHKVLKATRFVGRLGHDELLQALQSADAAVLPSH
YEPFGIVALEAAATGTPLVTSNVGGLGEAVIDGQTGMSFAPRDVAGLAAAVRAVLDDPEA
AQRRAIAARERLSADFDWHTVAAETSQVYLAAKRAEREPHPRRPIIEHALPDR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgatggtgtcatgggagtacccacccgtcgtcgtcggcggtctgggccga
cacgtgcaccacctggccaccgcactggccgaagcaggacacgagatcgtggtcctgagc
cgcaggcccaccgacaccgacccgagcacccatccgtcgacagacgaggtcagcgagggc
gtccgcgtggtggccgcagcgcaggatccacacgagttcgagttcggtaccgacatgatg
gcctggaccctggccatggggcactccatggtgcgcaccggccttgccgtcaaagacaat
tcgggtgaccgctgggtccccgacctcgtgcacgcgcacgactggctcgtcgcccatccg
gcgatcgccctggccgagtatttcgacgtaccactggtttccaccatccacgccactgag
gcgggccggcattccgggtgggtctcagggccgatcagccgccaggtacacgccgtcgag
tcgtggctggtgcgcgaatccgattcgctgatcacatgttcggcgtccatgagcgatgag
atcacccagctgttcggacccgaactgtccgagatccgggtcatccgcaacgggatcgac
gccgatctctggccgttcgccccccggcgtccccggcagggtcctcccgagttgctctac
ctcggtcgcctggaatacgagaagggcgtgcacgacgcgatcgcggccctcccccgcatc
cggcgcgcacacccgggcaccacgctcaccatcgccggcgacggcacccaacagcagtgg
ctcgtcgagcaggcacgaaagcacaaggtgctcaaggcaacccgattcgtcggacggctc
ggccacgacgagttgctgcaagctctgcagtcggccgacgccgccgtcctgcccagccac
tacgagccgttcggcattgtcgcgctggaggccgcggccaccggaacccccctggtgacc
tcgaacgtcggcggcctgggcgaggcggtgatcgacggtcagaccggaatgtcattcgcg
ccaagggatgtggccgggctggccgccgcggtccgtgcggtactggatgatcctgaagcc
gcgcagcggcgggcgatcgcggcacgcgagcggctcagcgcagatttcgactggcacacc
gtggccgccgagaccagccaggtctacctggccgccaaacgggccgaacgggagccacat
ccgcgccggccgatcatcgagcacgcgctgcccgaccgctga

DBGET integrated database retrieval system