KEGG   Mycobacterium sp. VKM Ac-1817D: G155_18915Help
Entry
G155_18915        CDS       T03634                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00260  Glycine, serine and threonine metabolism
myv01100  Metabolic pathways
myv01110  Biosynthesis of secondary metabolites
myv01120  Microbial metabolism in diverse environments
myv01130  Biosynthesis of antibiotics
myv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G155_18915
Enzymes [BR:myv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     G155_18915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIY49596
UniProt: A0A0A1FYK5
Position
3951094..3952116
Genome map
AA seq 340 aa AA seqDB search
MPSHAFASDNAAPAHPKVIDAIAAANTGSAASYGNDPVTQRAAEAIKDAFASPDAEVLFA
LTGTAANVIALASAVRPWQEILCSDIAHSLVDEAGGPVRLSGAQLTKLPSDNGVIDPAEL
DTAVARRGPVHHSQPRIVSITQSTENGRVWAPEAIEEFIGHAHELELLVHVDGSRIANAV
AALAMSPLEAVADADIVTVGGTKNGMLMGDAILVRRPELFDGIRFVQKQIGQLASKQRFI
AAQFEAMLDDGLWLQTAAHANRMAARLSAGLQALGLTLVSPTEANEIFVDLEPAAYSALS
AEYAVHRPDPRLPTVRLVCSWATTEAEIDDVLRLLASTST
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgccttctcacgcgttcgcctcggacaacgccgcgcccgcacaccccaaggtgatcgac
gccatcgccgcggccaacaccggctccgccgcgtcttacgggaacgatccggtcacccag
cgtgcggccgaggccatcaaggacgccttcgcctcccccgacgccgaggtgctgttcgcg
ctcaccggcaccgccgccaatgtcatcgcgctggcctcggcggtgcggccgtggcaggag
atcctgtgcagcgatatcgcgcactcgctcgtcgacgaagcgggcgggccggtccggctc
tcaggtgcccagctgaccaagctgcccagcgacaacggcgtgatcgatccggccgagctc
gacaccgcggtggcccgacgcggcccggtacaccactcacaaccgcgcatcgtcagcatc
acccagtccaccgagaacggccgggtctgggctccggaggccatcgaggagttcatcggc
cacgctcacgagctcgaactgctcgtccacgtcgacgggtcccggatcgccaatgcggtt
gccgcgctggccatgtctccgctggaggcggtcgcggacgccgacatcgtcaccgtaggt
ggcaccaagaacggcatgctgatgggcgatgcgatcctggtccgccgccccgagttgttc
gacggaatccgcttcgtgcaaaagcagatcggccagctggccagcaagcagcgcttcatc
gccgcacagttcgaggcgatgctggacgacgggttgtggctgcagaccgctgcccacgcc
aaccggatggccgcccggctcagtgcgggactacaggcgctcggcctgacgttggtatcc
cccaccgaggccaacgagatattcgtcgacctcgaacccgctgcctactcggcactctca
gccgagtacgccgtgcaccgccccgacccccggctgcccaccgtgcggttggtctgttcg
tgggcgacgacagaagccgaaatcgacgatgttctgcggttgctggcgtcgacttctacc
tga

DBGET integrated database retrieval system