KEGG   Mycobacterium sp. VKM Ac-1817D: G155_20900Help
Entry
G155_20900        CDS       T03634                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00071  Fatty acid degradation
myv00072  Synthesis and degradation of ketone bodies
myv00280  Valine, leucine and isoleucine degradation
myv00310  Lysine degradation
myv00362  Benzoate degradation
myv00380  Tryptophan metabolism
myv00620  Pyruvate metabolism
myv00630  Glyoxylate and dicarboxylate metabolism
myv00640  Propanoate metabolism
myv00650  Butanoate metabolism
myv00900  Terpenoid backbone biosynthesis
myv01100  Metabolic pathways
myv01110  Biosynthesis of secondary metabolites
myv01120  Microbial metabolism in diverse environments
myv01130  Biosynthesis of antibiotics
myv01200  Carbon metabolism
myv01212  Fatty acid metabolism
myv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:myv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    G155_20900
   00630 Glyoxylate and dicarboxylate metabolism
    G155_20900
   00640 Propanoate metabolism
    G155_20900
   00650 Butanoate metabolism
    G155_20900
  Lipid metabolism
   00071 Fatty acid degradation
    G155_20900
   00072 Synthesis and degradation of ketone bodies
    G155_20900
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    G155_20900
   00310 Lysine degradation
    G155_20900
   00380 Tryptophan metabolism
    G155_20900
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G155_20900
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G155_20900
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    G155_20900
Enzymes [BR:myv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     G155_20900
Exosome [BR:myv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G155_20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Gemin7
Motif
Other DBs
NCBI-ProteinID: AIY47609
UniProt: A0A0A1FVG4
Position
complement(4390577..4391737)
Genome map
AA seq 386 aa AA seqDB search
MPEAVIVSALRTPIGTARKGTLRDTDAYALADHVVRAAVEDLAGRGTVPVDDVILGEGLY
GGGVIARHAAITAGLTTVPGASVNRHCAAGQAAVQNAAAGIRAGMDRLVVAGGVNSASTS
PRFVRAASSAKDAEWVNWFPPTHPDTPDAPNMDMSITVGWNAAVKAGVSREEMDQWALSS
HRKAIAAIDEGRFKEEIVPIRTPHGLFDTDEHPRRDTTLEKLAALKPLHPEIEGFSITAG
NACGANDAAAVLAIASDKLGLPALATIKSWASVGVDPASTGLAPVEAITKALGRAGLSLS
DVDLFEINEAFASMCVATIKLLDIDPEIVNVSGSGCSLGHPVAATGARMLATMVHELQRR
GGGIGVAAMCAGGGMGSATVIEVLSP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagccgtcatcgtgtccgcgttgcgtacccccatcggcactgccaggaagggc
acgctgcgcgatacggacgcctacgcgctcgccgatcatgtggtgcgcgcggcggtcgag
gatcttgccgggcgcggcacggttcccgtcgacgacgtgatcctcggtgagggtctatac
ggcggcggcgtcatcgcccgtcatgccgccattaccgccggcctcaccacggttcccggt
gcttctgtcaatcggcattgcgctgccggtcaggccgccgtgcagaacgccgccgccggc
atccgcgccgggatggaccggttggttgtggccggtggcgtcaactcggcctccacgtcg
ccgcggttcgtccgcgcggcgagtagtgccaaggatgccgaatgggtgaactggttcccg
ccgacccatccggacaccccggacgcgccgaacatggacatgtcgatcaccgtcggatgg
aacgcggcagtcaaggccggggtgagccgcgaggagatggaccagtgggcgctgagctca
caccgcaaggccatcgctgcgatcgacgagggacggttcaaggaggagattgttccgatc
cggacgccgcacgggctgttcgacaccgacgagcatcctcgccgcgacaccacgctggaa
aagctggccgcgctcaagccgctgcatcccgagatcgaggggttctccatcaccgcgggc
aatgcgtgtggcgcgaacgatgcggcggcggtgctggccatcgccagcgacaagctcggg
ctgccggccctggccaccatcaagtcctgggcatcggtgggggtggacccggcctcgacc
gggctggcaccggtagaggccatcaccaaagcccttggccgggccggtctttcgttgtca
gatgtagacctgttcgaaatcaacgaggcgttcgcatcaatgtgtgtggcgaccatcaag
cttctcgacatcgaccctgagatcgtcaacgtcagcggcagcggatgctcgctgggtcac
ccggtggcagcaacgggggcgcgcatgctggccaccatggtccacgagttgcagcggcgc
ggcggcggcatcggggtggccgcgatgtgtgccgggggtgggatgggttcggcaactgtc
atcgaggtgctttcgccgtag

DBGET integrated database retrieval system